SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009825 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009825
Domain Number 1 Region: 92-452
Classification Level Classification E-value
Superfamily ARM repeat 7.82e-109
Family Diap1 N-terninal region-like 0.00000000000661
Further Details:      
 
Domain Number 2 Region: 796-1121
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 2.75e-101
Family Formin homology 2 domain (FH2 domain) 0.0000000000141
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000009825
Domain Number - Region: 471-550
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.023
Family FCH domain 0.047
Further Details:      
 
Domain Number - Region: 637-719
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0889
Family beta-sandwich domain of Sec23/24 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009825   Gene: ENSPANG00000014874   Transcript: ENSPANT00000012830
Sequence length 1207
Comment pep:known_by_projection chromosome:PapAnu2.0:6:135009582:135112482:-1 gene:ENSPANG00000014874 transcript:ENSPANT00000012830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPGGGLGPGRGTRDKKKGRSPDELPSAGGDGGKSKKFTLKRLMADELERFTSMRIKKE
KEKPNSAHRNSSASYGDDPTAQSLQDVSDEQVLVLFEQMLLDMNLNEEKQQPLREKDIII
KREMVSQYLYTSKAGMSQKESSKSAMMYIQELRSGLRDMPLLSCLESLRVSLNNNPVSWV
QTFGAEGLASLLDILKRLHDEKEETAGSYDSRNKHEIIRCLKAFMNNKFGIKTMLETEEG
ILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLD
GLKSGTTIALKVGCLQLINALITPAEELDFRVHIRSELMRLGLHQVLQDLREIENEDMRV
QLNVFDEQGEEDSYDLKGRLDDIRMEMEYFNEVFQILLNTVKDSKAEPHFLSILQHLLLV
RNDYEARPQYYKLIEECISQIVLHKNGADPDFKCRHLQIEIEGLIDQMIDKTKVEKSEAK
AAELEKQLDSELTARHELQVEMKKLESDFEQKLQDLQGEKDALHSEKQQIATEKQDLEAE
VSQLTGEVAKLTKELEDAKKEMASLSAAAITVAPSVPSSAAAPPALPLPGDSGTIIPPPP
APGDSTIGSVCISSTPSLPGGTAIPPPPPLPEGASIPPPPPLPEGASIPPPPPLPGDAGI
PPPPPPLPGGAGMFPGGPGIPPPPPGMGMPPPPPFGFGASAAPVLPFGLTPKKLYKPEVQ
LRRPNWSKLVAEDLSQDCFWTKVKEDRFENNELFAKLTLTFSAQTKRTKKGKKQQYDENQ
QLSLQAQKKILELERLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIK
QMPEPEQLKMLSELKDEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPE
IVSVTAACEELRKSESFSSLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQK
MTLLHFLAELCENDYPDVLKFPDELAHVEKASRVVSAENLQKNLDQMKKQISDVERDVQN
FPAATDEKDKFVEKMTIFVKDAQEQYNKLRMMHSNMETLYKELGDYFLFDPKKLSVEEFF
MDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDE
TGVMDSLLEALQSGAAFRRKRGPRQANRKAGCAKDDAMAAVPAKVSKKNETFPTILEEAK
ELVGRAS
Download sequence
Identical sequences ENSPANP00000009825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]