SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009865 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009865
Domain Number 1 Region: 495-527,567-624
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000628
Family Anti-sigma factor antagonist SpoIIaa 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009865   Gene: ENSPANG00000010066   Transcript: ENSPANT00000002739
Sequence length 653
Comment pep:known_by_projection chromosome:PapAnu2.0:8:86767901:86915109:1 gene:ENSPANG00000010066 transcript:ENSPANT00000002739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGAKKKKKSMLWGKMHTPQCEDIIQWCRRRLPILDWAPHYNLKENLLPDTVSGIMLAVQ
QVTQGLAFAVLSSVHPVFGLYGSLFPAIIYAIFGMGRHVATGTFALTSLISANAVERIVP
QNIQNLTTPSNTSVMGLSDFEMQRIHVAVAVSFLGGVIQVAMFVLQLGSATFVVTEPVIS
AMTTGAATHVVTSQVKYLLGMKMPYISGPLGFFYIYAYVFENIKSVRLEALLLSLLSIVV
LVLVKELNEQFKRKIKVVLPVDLVLIIAASFACYCTNMENTYGLEVVGHIPQGIPSPRAP
PMNILSAVITEAFGVALVGYVASLALAQGSAKKFKYSIDDNQEFLAHGLSNIVSSFFFCI
PSAAAMGRTAGLYSTGAKTQVACLISCIFVLIVIYAIGPLLYWLPMCVLASIIVVGLKGM
LIQFRDLKKYWNVDKIDWGIWVSTYVFTICFAANVGLLFGVVCTIAIVIGRFPRAMTLSI
KNMKEMEFKVKTEMDSETLQQVKIISINNPLVFLNAKKFYTDLMNIIQKENSCNQPLDDI
SKCEQNTLLNSLSNGNCNVEKVSQSCPNEKCSLILDCSGFTFFDYSGVSMLVEVYMDCKG
RSVDVLLAHCTASLIKGMTYYGNLDSEKPSVSAAISHIHSNKNLSKLSDHSEV
Download sequence
Identical sequences ENSPANP00000009865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]