SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009944 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009944
Domain Number 1 Region: 3-79
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000076
Family Selenoprotein W-related 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009944   Gene: ENSPANG00000014328   Transcript: ENSPANT00000010872
Sequence length 87
Comment pep:known_by_projection chromosome:PapAnu2.0:19:41073268:41078938:1 gene:ENSPANG00000014328 transcript:ENSPANT00000010872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALAVRVVYCCDLTLHFQYLQLKKKLEDEFPGRLDICGEGTPQATGFFEVMVAGKLIHSK
KKGDGYVDTESKFLKLVAAIKAALAQG
Download sequence
Identical sequences ENSPANP00000009944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]