SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009999 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009999
Domain Number 1 Region: 41-206
Classification Level Classification E-value
Superfamily EF-hand 2.46e-36
Family Calmodulin-like 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009999   Gene: ENSPANG00000011302   Transcript: ENSPANT00000018645
Sequence length 208
Comment pep:known_by_projection chromosome:PapAnu2.0:6:35322164:35358882:-1 gene:ENSPANG00000011302 transcript:ENSPANT00000018645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTARHDREMATQAKKKLTTATDPIERLRLQCLARGSAGIKGLGRVFRIMDDDNNRTLD
FKEFMKGLNDYAVVMEREEVEELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAF
RKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWSEEQVFRKFLDNFDSPYDKDGLVTPEE
FMNYYAGVSASIDTDVYFIVMMRTAWKL
Download sequence
Identical sequences A0A096NB78 A0A2K5MP49 A0A2K5YCZ4
ENSPANP00000009999 XP_011857768.1.47321 XP_011857769.1.47321 XP_011910559.1.92194 XP_011910560.1.92194 XP_011910561.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]