SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010014 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010014
Domain Number 1 Region: 31-246
Classification Level Classification E-value
Superfamily t-snare proteins 3.92e-59
Family t-snare proteins 0.0000000555
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010014   Gene: ENSPANG00000010433   Transcript: ENSPANT00000006955
Sequence length 289
Comment pep:known_by_projection chromosome:PapAnu2.0:14:13748376:13790006:-1 gene:ENSPANG00000010433 transcript:ENSPANT00000006955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDRLEQLKAKQLTQDDDTDEVEIAIDNTAFMDEFFSEIEETRLNIDKISEHVEEAKKLY
SIILSAPIPEPKTKDDLEQLTTEIKKRANNVRNKLKSMEKHIEEDEVRSSADLRIRKSQH
SVLSRKFVEVMTKYNEAQVDFRERSKGRIQRQLEITGKKTTDEELEEMLESGNPAIFTSG
IIDSQISKQALSEIEGRHKDIVRLESSIKELHDMFMDIAMLVENQGEMLDNIELNVMHTV
DHVEKARDETKKAVKYQSQARKKLIIIIVLVVVLLGILALIIGLSVGMS
Download sequence
Identical sequences ENSPANP00000010014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]