SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010016 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010016
Domain Number 1 Region: 506-571
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.14e-20
Family Complement control module/SCR domain 0.005
Further Details:      
 
Domain Number 2 Region: 207-264
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000877
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 3 Region: 449-508
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000222
Family Complement control module/SCR domain 0.00087
Further Details:      
 
Domain Number 4 Region: 266-322
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000729
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 5 Region: 387-442
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000139
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 6 Region: 146-202
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000144
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 7 Region: 85-142
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000315
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 8 Region: 41-90
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000364
Family Complement control module/SCR domain 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000010016
Domain Number - Region: 329-381
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00124
Family Complement control module/SCR domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010016   Gene: ENSPANG00000012829   Transcript: ENSPANT00000002736
Sequence length 577
Comment pep:known_by_projection chromosome:PapAnu2.0:1:166956597:166997393:-1 gene:ENSPANG00000012829 transcript:ENSPANT00000002736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLMISVILISQISSVGGEATLCDFPKIRHGFLYDEENYKPFAQVPIGEVFYYSCEYNFV
SPSKSFWTRITCTEEGWSPTPKCLRMCSFPFVKNGHSESSGQIHLEGDTVQIVCNAGYSL
QNKEKSISCVERGWSAPPKCSFTKEECHVPILEANVDAKPEKESYKVGDVLKFSCRKNLK
RVGPDSVQCYQFGWSPNFPTCKERVQSCGPPPQLSNGEVKEIRKEEYGHNEVVEYYCNRN
FIIKGPKKIQCVDGKWTTLPTCVEQVKTCGYIPELQYGYVQQSVPPYQHGVSVEVNCRNE
YTMIGNNEITCIDGLWTELPMCVATHQLKRCKISGVNIKTLFRSSGNEFNHNARIRYRCL
DIPGYRYSVCINGKWNPELDCTGQKEQFCPPPPQIPNAQNMTTTVNYQDGEKVAVLCKEN
YLLPEAKEIVCKNGRWQSLPHCVESTAYCGPPPSINNGDITSFPLSVYPPWSTVTYRCQS
FYELQGSATVTCRNKQWSEPPRCLDPCVISEENMNKNNIQLRWRNNEKLYVKTGDTVEFQ
CKFLYKAKISSPSFRAICQEGKFEYPICERSELNFPE
Download sequence
Identical sequences A0A096NB91
ENSPANP00000010016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]