SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010036 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010036
Domain Number 1 Region: 184-527
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.24e-86
Family Protein kinases, catalytic subunit 0.000000283
Further Details:      
 
Domain Number 2 Region: 31-181
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.07e-43
Family Regulator of G-protein signaling, RGS 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010036   Gene: ENSPANG00000020835   Transcript: ENSPANT00000016635
Sequence length 589
Comment pep:known_by_projection chromosome:PapAnu2.0:6:170794949:170811681:1 gene:ENSPANG00000020835 transcript:ENSPANT00000016635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELENIVANTVLLKAREGGGGNRKGKSKKWRQMLQFPHISQCEELRLSLERDYHSLCERQ
PIGRLLFREFCATRPELSRCIAFLDGVAEYEVTPDEKRKACGRQLMQNFLSHTGPDLIPE
VPRQLVTNCTQRLEQGPCKDLFQELTRLTHEYLSVAPFADYLDSIYFNRFLQWKWLERQP
VTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGEAMALNEKQILEK
VNSRFVVSLAYAYETKDALCLVLTLMNGGDLKFHIYHMGQAGFPEARAVFYAAEICCGLE
DLHRERIVYRDLKPENILLDDHGHIRISDLGLAVHVPEGQTIKGRVGTVGYMAPEVVKNE
RYTFSPDWWALGCLLYEMIAGQSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQARSLC
SQLLCKDPAERLGCRGGSAREVKEHPLFKKLNFKRLGAGMLEPPFKPDPQAIYCKDVLDI
EQFSTVKGVELEPTDQDFYQKFATGSVPIPWQNEMVETECFQELNVFGLDGSVPPDLDWR
GQPPAPPKKGLLQRLFSRQRIAVETAATARKSSPPASSPQSEAPTGSWR
Download sequence
Identical sequences A0A096NBB0 H9YV86
ENSPANP00000010036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]