SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010043 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010043
Domain Number 1 Region: 1635-1760
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000196
Family Synaptotagmin-like (S variant) 0.057
Further Details:      
 
Domain Number 2 Region: 1431-1556
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000278
Family PLC-like (P variant) 0.046
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000010043
Domain Number - Region: 1199-1355
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000246
Family Synaptotagmin-like (S variant) 0.034
Further Details:      
 
Domain Number - Region: 826-906
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000409
Family PLC-like (P variant) 0.029
Further Details:      
 
Domain Number - Region: 611-701
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.054
Family Synaptotagmin-like (S variant) 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010043   Gene: ENSPANG00000017376   Transcript: ENSPANT00000014715
Sequence length 2354
Comment pep:known_by_projection chromosome:PapAnu2.0:14:63873794:64037398:-1 gene:ENSPANG00000017376 transcript:ENSPANT00000014715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQRKGQGPGGSRGRKKRGLSDISPSTSLPPLVEGQLRCFLKLTINRVIWKIAKPPTCVL
VRVRWWGETSDGTLFCPRDALQTEPKAVRTTTRYAIRCGPKQFTSYLTDMAVLVLEVITK
LDHLPIGRVQINGLAQLSPTHQINGFFTIVSSTSKKLGELQVSLALEPLSETYDSYHPLP
TTDMTENVLLSKQGFRENTEPSSTQFQVPSRPRDIHTIKIDGKELGANSSRSTTPSRGKD
HVYFAENPDTIKDSSFGLQHHLNSGQSLESVTLKGRAPRKQMSLLNSCEFQPQIRTVAKS
HSDSCILSSNNPPTKDLLSALLEQGNKLRNAMVISAMKSSPETSVLLDQVHPPINEDSLR
ASTQSRAFSRNQFKDHIEDHLLPSTENTFWRHDTKADTRAIQLLLGSAELSQGNFWDGLG
SPPDCPSPGSDVYCSSELNDPQYDQSLLENLFYTVPKSDTSISDFLSEEDDDVPSKKISQ
STALARSSKVLESSDHKLKKRSTGKKNRNLVEQQMLSETPEDTQTMTLSVDRLALLGRTH
SVRIIIETMGIPPDNHQMTPDKKSYAGTPPKVTTAKKRTFFVEYHFPVGFSESGLGKTAL
ITEVVRLASSKITNGKVKFQQRFVFPVQFGGPMIEHWWNSNLTFQIYAKKTPQKKPEVIG
SASLSLRAVIQSELLSFSDQLPVQQENDQTLFGPLKVTMELVTDNKDFTGVNTKLSGNTH
YTPLCAPTSPNKALPELNQDMTYTKNPQNLNQIHEETAKKAQNLVLPTRKSPSPLAPHPS
TFMAMPASHNLVIQTNRSTKESALLLHVLLMVPDGKDFISGESEKQSPCNVYLNCKLFST
EEVTRSVIAWGTTQPFNFSQVIPVSLSSKYLERLKNNVMVIETWNKVRSPGLDKLLGLVK
LPLHQFYMSFKDPKISRLLLDAQYPVVAVDRYMPVIDVFSGHQNGSLRVFLAMGSSDQIM
ALQRLKHEEGTLPPFSPRPAHFLDQPTVASVAMAEDRGNALMEHCFEIHVEMVKGLAPLQ
ATVWGEADCYVQYYFPVQHSQSSVLKGPEFLENGITLKPFRTATTLCVPDPIFNSEHHHS
LLLPAEVPVQRLLLSAFSAQGLVPGGGVQFEIWCRYYYPNVRDQMVAKGTLPLSRICAMV
TTQHREDVGIQTFNLPLTPRIENRKELRNQSSGLLDVGLRYRRSPRTAEGVLAARTVSIS
VQIIRACGLQAAAKALAEQEPALQFSATVGVNASVTTHLSFLPQGEQRRTHPVACSFCPE
FSHHVEFTCNLVTQHCSGEACFLAELLEFAEVIFAVYHENTKSASDIISIESCKEYLLGV
VKVPTKELLIKRSGITGWYPIILPEDGGLPHGLELMQKIVGGLELSVSFTHRGDRERVLE
AAELLGWSFENSLKDFVRMDEGEPATVTISTPRLWLPIHCVLLAGHNHIHKNTYCYLRYK
FYDHEAFWTPLKKPKESVNKKQIIVTFKASKRAEVTRGPSLLWYFREERLEIQVWQAYGN
DSVERPHQTDSWIGSAYVDLARLGERSARTLTVSGVYPLFGRNASNLSGAALRVHVVLSS
LSSHLEPTHELDSMDCSSHSESEQLPRRNDEVQLSPPEEVSCHQKSPASTQVPCSSTTAE
VCLTQEGPAELDGTFAVSILVERAMHLSLKGSPLTERKVSIPSCCVSFATADESSPVYTQ
VVENTDSPIWNFQQQSRLSKELLLDPQQTLVFKVWHKGDEERVIGFASVDLSPLLSGFQF
VCGWYNITDFSGECQGQIKVAVSPLESLIHFKEERQARRGVETSKSLIPIYSPFSFPASD
MYAAFSSHMARQTLDQLAHASSKELDFSSPGSRSGTTRNQASRHEEHVQNIRRFHESLHL
QGEALLPCDDKLTTSPLSSQTSILTSLRKNLSELDQIQRYFSQKLTKPFLPLSPQTQMAI
SQHQESCRDHLEPGASSLDPGSQCILEKSNNLVLQVSSLITADLQTITRDSQAALSSHRA
RSRNNKATTLPDARDTEALQEQCTMPDEPLARAPDKGTDSPPPPPLEETSNGGRMLHESL
RHTVPITRMQSSEDTEAGPAYSDEDYEEDIIEPRTLNEITTVTDKTSPWSSFISDTSDVI
SPQPDEVQREGPSCPSPGPFYREELTVKSSFLSSPERAVNSHLPREGSPSQSLVACEGEA
SKAKISGESASANPQPIPCPTLSGAQQSRTFVGWSSPQADQNKEPKSEAPAENEAATSEL
SDSADSFKKLPLNLASQSRREKHKGPPIDSSDIRQRQVTTGSETSTKHSLLLYPLAFPTS
ILPPEVLSKSVEDLALSATLPPAATTDQDKSEATRGALSQRPCRPRPNSLPPNLPEEETR
RIARIFSSRYSQKD
Download sequence
Identical sequences ENSPANP00000010043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]