SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010118 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010118
Domain Number 1 Region: 445-524
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.29e-21
Family Complement control module/SCR domain 0.0058
Further Details:      
 
Domain Number 2 Region: 202-258
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000118
Family Complement control module/SCR domain 0.00067
Further Details:      
 
Domain Number 3 Region: 143-197
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000032
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 4 Region: 79-137
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000341
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 5 Region: 326-383
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000459
Family Complement control module/SCR domain 0.00098
Further Details:      
 
Domain Number 6 Region: 386-442
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000144
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 7 Region: 17-76
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000354
Family Complement control module/SCR domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010118   Gene: ENSPANG00000021908   Transcript: ENSPANT00000022543
Sequence length 525
Comment pep:known_by_projection chromosome:PapAnu2.0:1:166916509:166943399:1 gene:ENSPANG00000021908 transcript:ENSPANT00000022543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTTCTTEGWSPEPRCFKKCTKPDLSNGYISDVKLLYKIQENMHYGCASGYKTTGGKDEEV
VQCLSDGWSSQPTCSFTKREICHVNRLIENGYFYPVKQTYEEGDVIQFFCHENYYLSGSD
LIQCYNFGWYPESPVCEEGRRNRCPPPPLPINSKIQTHSTTYRHGEIVHIECELNFVIHG
SEEIRCENGKWTEPPKCIGQERVACEEPPFIENGTANLHSKIYYNGDKVTYACKSGYLLR
GSNEITCNRGKWTLAPECVVLQRGKKMDISSVGRLRPEMKSNEKEENKKLTIIFRLKNSF
SFYRFKKCLHSHINLKQPVFLENNENCKHPPVVMNGAVADGLLASYAAGSSVEYRCNEYY
LLRGSKISRCEQGKWSSPPVCLESKGMCTSPPLIKHGDIISSIVDTYENGSSVEYRCFDH
HFLQGSREAYCLEGTWTTPPLCLEPCTLSFTEMEKNNLLLKWDFDNRPHILHGEYVEFIC
RGDTYPAELYITGSILRMQCDRGQLKYPRCIPRQRTLSYQEPLRT
Download sequence
Identical sequences ENSPANP00000010118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]