SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010152 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010152
Domain Number 1 Region: 8-65
Classification Level Classification E-value
Superfamily Kringle-like 7.85e-20
Family Fibronectin type II module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010152   Gene: ENSPANG00000021069   Transcript: ENSPANT00000011644
Sequence length 69
Comment pep:novel chromosome:PapAnu2.0:19:41206108:41215396:-1 gene:ENSPANG00000021069 transcript:ENSPANT00000011644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WCSLDKEFQGRWRYCTGLDSPQCVFPFVFRQKAIHNCTKEGYILNRSWCSLTENYDKDRK
WKQCSPQNT
Download sequence
Identical sequences ENSPANP00000010152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]