SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010163 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010163
Domain Number 1 Region: 61-187
Classification Level Classification E-value
Superfamily PH domain-like 6.46e-52
Family Phosphotyrosine-binding domain (PTB) 0.0000688
Further Details:      
 
Domain Number 2 Region: 531-606
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000197
Family SH3-domain 0.00005
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000010163
Domain Number - Region: 726-781
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000178
Family Pointed domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010163   Gene: ENSPANG00000021261   Transcript: ENSPANT00000001123
Sequence length 822
Comment pep:known_by_projection chromosome:PapAnu2.0:11:15317448:15482301:-1 gene:ENSPANG00000021261 transcript:ENSPANT00000001123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGHISNHPSSFGMYPSQMNGYGSSPTFSQMDREHGSKTSAKALYEQRKNYARDSISSVS
DISQYRVEHLTTFILDRKDAMITVDDGIRKLKLLDAKGKVWTQDMILQVDDRAVSLIDLE
SKNELENFPLNTIQHCQAVMHSCSYDSVLALVCKEPTQNKPDLHLFQCDEVKANLISEDI
ESAISDSKGGKQKRRPDALRMISNADPGIPPPPRAPAPAPPGTVTQVDVRSRVAAWSAWA
ADQGDFEKPRQYHEQEETPEMMAARIDRDVQILNHILDDIEFFITKLQKAAEAFSELSKR
KKNKKGKKKGPGEGVLTLRAKPPPPDEFLDCFQKFKHGFNLLAKLKSHIQNPSAADLVHF
LFTPLNMVVQATGGPELASSVLSPLLSKDTIDFLNYTVNGDERQLWISLGATWMKARAEW
PKEQFIPPYVPRFRNGWEPPMLNFMGATMEQDLYQLAESVANVAEHQRKQEIKRLSTEHS
SVSEYHPADGHAFGSNIYPRGSHLDQGEAAVAFKPTSNRHIDRNYEPLKSQPKKYAKSKY
DFVARNNSELSVLKDDILEILDDRKQWWKVRNASGDSGFVPNNILDIVRPPESGLGRADP
PYTHTIQKQRMEYGPRPADTPPAPSPPPTPAPVPVPLPPSTPAPVPVSKVPANVTRQNSS
SSDSGVNIMRDSQRHKQLPVDRRKSQMEEVQDELIHRLTIGRSAAQKKFHVPRQNVPVIN
ITYDSTPEDVKTWLQSKGFNPVTVNSLGVLNGAQLFSLNKDELRTVCPEGARVYSQITVQ
KAALEDSSGSSELQEIMRRRQEKISAAASDSGVESFDEGSSH
Download sequence
Identical sequences A0A096NBL0
ENSPANP00000010163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]