SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010166 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010166
Domain Number 1 Region: 514-576
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.06e-18
Family Complement control module/SCR domain 0.004
Further Details:      
 
Domain Number 2 Region: 210-274
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000301
Family Complement control module/SCR domain 0.00065
Further Details:      
 
Domain Number 3 Region: 457-515
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000564
Family Complement control module/SCR domain 0.00066
Further Details:      
 
Domain Number 4 Region: 341-398
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000971
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 5 Region: 94-151
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000012
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 6 Region: 394-451
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000375
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 7 Region: 147-204
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000459
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 8 Region: 22-87
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000082
Family Complement control module/SCR domain 0.0084
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000010166
Domain Number - Region: 269-334
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000486
Family Complement control module/SCR domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010166   Gene: ENSPANG00000008919   Transcript: ENSPANT00000004498
Sequence length 577
Comment pep:known_by_projection chromosome:PapAnu2.0:1:167014062:167060303:-1 gene:ENSPANG00000008919 transcript:ENSPANT00000004498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLINVILTLWVSCANGQVKPCNFPEIQHGGLYYESKRRPYFPVAAGKSYSYYCDANFV
TPSGSYWDYIHCTQDGWSPTVPCLRTCSKSDIEVENGFISESSSIYILNKEMQYKCKPGY
ATADGNSSGSITCLQNGWSAQPICIKLCDTPVFENSRAKSNGMWFKLHDTLDYECYDGYE
SRYGNTTGSIVCGEDGWSHLPTCYNSSEKCGPPPPISNGDTKSFPQKVYLPQSTVEYQCQ
SYYELQGSQYVTCSNGEWSEPPRCRLMKPCEFPEIQHGGLYYETIRRPYFPVAAGKSYSY
YCDANFVTPSGSYWDYIHCTQDGWLPTVPCLRTCSKSDIEIENGFISESSSIYILNKEMQ
YKCKPGYATADGNSSGSITCLQNGWSAQPICIKFCDTPVLENSRAKSNGMWFKLHDTLDY
ECYDGYESRYGNTTGSIVCGEDGWSHLPTCYNSSEKCGPPPPISNGDTKSFPQKVYLPQS
TVEYQCQSYYELQGSQYVTCSNGEWSEPPRCINPCIITEENMNKNNIQLKGKSDRNYYAK
TGDTIEFMCKLGYNANTSILSFQAVCWEGILEYPRCE
Download sequence
Identical sequences ENSPANP00000010166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]