SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010169 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000010169
Domain Number - Region: 252-369
Classification Level Classification E-value
Superfamily TPR-like 0.000222
Family Tetratricopeptide repeat (TPR) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010169   Gene: ENSPANG00000005529   Transcript: ENSPANT00000010536
Sequence length 575
Comment pep:known_by_projection chromosome:PapAnu2.0:1:113335759:113428363:-1 gene:ENSPANG00000005529 transcript:ENSPANT00000010536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGGGSGEAAAARASPAPVPGLNPMLGWRERLRAGLAGTGASVWFVAGLGLLYALRIPL
RLCENLAAVTVFLNSLTPKFYVALTGTSSLISGLIFVFEWWYFHKHGTSFIEQVSVSHLQ
PLMGGTESSISEPGSPSRNRESETSRQNLSECKVWRNPLNLFRGAEYRRYTWVTGKEPLT
YCDMNLSAQDHQTFFTCDTDFLRPSDTVMQKAWRERNPPARIKAAYQALELNNDCATAYV
LLAEEEATTIVDAEKLFKQALKAGETIYRQSQQCQHQSPQHEAQLRRDTNVLVYIKRRLA
MCARKLGRIREAVKIMRDLMKEFPPLTMLNIHENLLESLLELQAYADVQAVLAKYDDISL
PKSAAICYTAALLKTRTVSEKFSPETASRRGLSTAEINAVEAIHRAVEFNPHVPKYLLEM
KSLILPPEHILKRGDSEAIAYAFFHLQHWKRIEGALNLLQCTWEGTFRMIPHPLEKGHLF
YPYPSCTEMADRELLPTFHHVSVYPKKELPLFIHFTAGFCSSTAMIAILTHQFPEIMGIF
AKAVLGLWRPQPWASSGFEENTQDLKLEDLGLSSG
Download sequence
Identical sequences A0A096NBL6
ENSPANP00000010169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]