SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010186 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010186
Domain Number 1 Region: 570-636
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000612
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 499-545
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000109
Family TSP-1 type 1 repeat 0.00069
Further Details:      
 
Domain Number 3 Region: 626-682
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000111
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 4 Region: 26-73
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000131
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000010186
Domain Number - Region: 78-119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000115
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number - Region: 451-489
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00733
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010186   Gene: ENSPANG00000002426   Transcript: ENSPANT00000024999
Sequence length 843
Comment pep:known_by_projection chromosome:PapAnu2.0:6:40370165:40448028:1 gene:ENSPANG00000002426 transcript:ENSPANT00000024999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAISLFILVGFIGEFQIFSSASSPVNCQWDSYAPWSECNGCTKTQTRRRSVAVYGQYGG
QPCVGNAFETQSCEPTRGCPTEEGCGERFRCFSGQCISKSLVCNGDSDCDEDSADEDRCE
DSERRPSCDIDKPPPNIELTGNGYNELTGQFRNRVINTKSFGGQCRKVFSGDGKDFYRLS
GNILSYTFQVKINNDFNYEFYNSTWSYVKHTSTEHTSSSRKRSFFRSSSSSSHSYSSQTN
EIHKRKSYQLLVVENTVEVAQFINNNPEFLQLAEPFWKELSHLPSLYDYSAYRRLIDQYG
THFLQSGSLGGEYRVLFYVDSEKLKQNDFGSVEEKKCKSSGWSFIIKFSSHGCKELEKAL
KASSGTQNNVLRGDPFIRGGGAGFISGLSYLELDNPAGNKRRYSAWAESVTDLPEVIKQK
LTPLYELVKEVPCASVKKLYLKRALEEYLDEFDPCHCRPCQNGGLATVSGTHCLCHCKPY
TFGAACEQGVLVGNQAGGVDGGWSCWSSWSPCVQGKKTRSRECNNPPPSGGGRTCIGETT
ESTQCEDEELEHLRLLEPHCFPLSLVPTKFCPSPPALKDGFVQDEGTTFPVGKNVVYTCN
EGYSLIGNPVARCGEDLRWLVGEMHCQKIACVLPVLMDGIQSHPQKPFYTVGEKVTVSCS
GGMSLEGPSTFLCGSSLKWSPEMKNARCVQKDNPLTQAVPECQRWEKLQNSRCVCKMPYE
CGPSLDVCARDERSKRILPVTVCKMHVLHCQSRNYTLTGRDSCTLPASAEKACGACPLWG
KCDAESSKCVCREASECEEEGFSICVEVNGKEQTMSECEAGALRCRGQSISVTSIRPCAA
ETQ
Download sequence
Identical sequences A0A096NBN3
ENSPANP00000010186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]