SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010233 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000010233
Domain Number - Region: 353-415
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.034
Family beta-sandwich domain of Sec23/24 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010233   Gene: ENSPANG00000011213   Transcript: ENSPANT00000026962
Sequence length 603
Comment pep:known_by_projection chromosome:PapAnu2.0:5:75109816:75182338:-1 gene:ENSPANG00000011213 transcript:ENSPANT00000026962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGEVERLVSELSGGTGGDEEEEWLYGGPWDVHVHSDLTKDLDENEVERPEEENASANP
PSGIEDETAENGVPKPKVTETEDDSDSDSDDDEDDVHVTIGDIKTGAPQYGSYGTAPVNL
NIKTGGRVYGTTGTKVKGVDLDAPGSINGVPLLEVDLDSFEDKPWRKPGADLSDYFNYGF
NEDTWKAYCEKQKRIRMGLEVIPVTSTTNKITAEDCTMEVTPGAEIQDGRFNLFKVQQGR
TGNSEKETALPSTKAEFTSPPSLFKTGLPPSRNSTSSQSQTSTASRKANSSVGKWQDRYG
RAESPDLRRLPGAIDVIGQTITISRVEGRRRANENSNIQVLSERSATEVDNNFSKPPPFF
PPGAPPTHLPPPPFLPPPPTVSTAPPLIPPPGIPITVPPPGFPPPPGAPPPSLIPTIESG
HSSGYDSRSARAFPYGNVAFPHLPGSAPSWPSLVDTSKQWDYYARREKDRDRERDRDRER
DRDRDRERERTRERERERDHSPTPSVFNSDEERYRYREYAERGYERHRASREKEERHRER
RHREKEETRHKSSRSNSRRRHESEEGDSHRRHKHKKSKRSKEGKEAGSEPAPEQESTEAT
PAE
Download sequence
Identical sequences A0A096NBS8 A0A0D9QY57 A0A2K5W200 A0A2K6B379 A0A2K6MPV5 F7HS24
XP_005555338.1.63531 XP_007996897.1.81039 XP_011770483.1.29376 XP_011928937.1.92194 XP_014994183.1.72884 XP_017748776.1.44346 ENSPANP00000010233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]