SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010258 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010258
Domain Number 1 Region: 144-460
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.25e-130
Family Transglutaminase core 0.00000000683
Further Details:      
 
Domain Number 2 Region: 2-143
Classification Level Classification E-value
Superfamily E set domains 1.15e-40
Family Transglutaminase N-terminal domain 0.0002
Further Details:      
 
Domain Number 3 Region: 616-714
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.88e-27
Family Transglutaminase, two C-terminal domains 0.00022
Further Details:      
 
Domain Number 4 Region: 503-614
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.4e-27
Family Transglutaminase, two C-terminal domains 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010258   Gene: ENSPANG00000018486   Transcript: ENSPANT00000003738
Sequence length 717
Comment pep:known_by_projection chromosome:PapAnu2.0:7:17812579:17839307:-1 gene:ENSPANG00000018486 transcript:ENSPANT00000003738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLEVALTDLQSSRNNVRHHTEEITVDHLLVRRGQAFNLTLYFRNRGFQPGLDNIIFVVET
GPLPDLALGTRAVFSLARHHSPSPWIAWLETNGATSTEVSLCAPPTAAVGRYLLKIHIDS
FQGSVTAYQLGEFILLFNPWCPEDAVYLDSEPQRQEYVMNDYGFIYQGSKNWIRPCPWNY
GQFEEKIIDICLKLLDKSLHFQTDPATDCALRGSPVYVSRVVCAMINSNDDNGVLNGNWS
ENYTDGANPAEWTGSVAILKQWYATGCQPVRYGQCWVFAAVMCTVMRCLGIPTRVITNFD
SGHDTDGNLIIDEYYDNTGRILGNKKKDTIWNFHVWNECWMARKDLPPGYGGWQVLDATP
QEMSNGVYCCGPASVRAIKEGEVDLNYDTPFVFSMVNADCMSWLVQGGKEQKLHQDTSSV
GNFISTKSIQSDERADITENYKYEEGSLQERQVFLKALQKLKAGRFHSSRRGAELQPSRP
TPLSRDSPRSLHTPSLRPSDVVQVSLKFKLLDPPNMGQDICFVLLALNMSSQFKDLKVNL
SAQSLLHDGSPLSPFWQDTAFITLSPKEAKTYPCKISYSQYSQYLSTDKLIRISALGEEK
SSPEKILVNKIITLSYPSITINVLGAAIVNQPLSIQVIFSNPLSEQVEDCVLTVEGSGLF
KKQQKVLLGVLKPQHQASIILETVPFKSGQRQIQANMRSNKFKDIKGYRNVYVDFAL
Download sequence
Identical sequences ENSPANP00000010258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]