SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010263 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000010263
Domain Number - Region: 810-948
Classification Level Classification E-value
Superfamily TPR-like 0.000854
Family Tetratricopeptide repeat (TPR) 0.062
Further Details:      
 
Domain Number - Region: 687-766
Classification Level Classification E-value
Superfamily TPR-like 0.0212
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 
Domain Number - Region: 443-561
Classification Level Classification E-value
Superfamily ARM repeat 0.0317
Family GUN4-associated domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010263   Gene: ENSPANG00000020279   Transcript: ENSPANT00000007982
Sequence length 1238
Comment pep:known_by_projection chromosome:PapAnu2.0:9:117242934:117288624:1 gene:ENSPANG00000020279 transcript:ENSPANT00000007982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDPKEARAEGPPAGAAARGGLSLLSQGESEEPSAQGSALFLGGNEVKSRAVVKYSSAPP
RTAFARLEEKTDLKLPPANWLRESAKLGPAGTTILGNSKKSKPFSSFGMAYDFIDSVGND
VDVVSDSENIKKLLKIPYSKSHVSMAVHRIGRTLLLDELDIQELFMRSSQTGDWTWLKEF
YQRLIDQKWQRKKKSKEHWYQKAILSKFLYYSINGDGAAQPVSSTAEQQESSSSDQTNDS
EGASWPAPFEMPSSVSEDPSASSQGSEPLEPSYIVGHVASAPKEQNLTTLFNDGEHSQGL
KNDFVRNILWTFEDIHMLVGSNMPIFGGGRYPAVSLRLRDNNKPINVLTGIDYWLDNLIC
NVPELVMCFHVNGIVQKYEMIKTEEIPNLENSNFSTKVIKDIAQNILSFLKSNCTKEGHT
YWLFKASGSDIVKLYDLTTLCEETEDKYQNPFTMPVAILLYKVACNMMMKKNQNKKHYGT
IRTLLLNCLKLLDKSRHPQIIASANYMLSELFQLDEPKKEENSESPLNENSDESYSEEEE
EMPDSDENGSYSTSSDPSDDSKAVAIIKSVGELSVPEKYKSIHQIRPSCAFPVCHDTEER
CRLVLSYVLEGLKSVDSSMKKESDLPAADPSTPIPLKYEDESTRGGPEGLEKQMALFLDK
MGSLQKGNYSSQSGMIPGSWQHKMKLQLILKSSKAYYVLSDAAMSLQKYGRALRYIKLAL
QSHDTYCCLCTNMLSEVLLFLSQYLTLCGDIQLMLAQNANNRAAHLEEFHYQTKEDQEIL
HSLHRESSCQGFAWATDLSTDLESQLSVSCKCYEAANEILQFSDLKSQNPEHYVQVLKRM
GNIRNEIGVFYMNQAAALQSERVVSKSVSAAEQQLWKKSFSCFEKGIHNFESIEDATNAA
LLLCNTGRLMRICAQAHCGAGDEFKREFSPEEGLYYNKAIDYYLKALRSLGTRDIHPAVW
DSVNWELSTTYFTMATLQQDYAPLSRKAQEQIEKEVSEAMMKSLKYCDVDSMSARQPLCQ
YRAATIHHRLASMYHSCLRNQVGDEHLRKQHRVLADLHYSKAAKLFQLLRDAPCELLRVQ
LERVAFAEFQMTSQNSNVGKLKTLSGALDIMVRTEHAFQLIQKELVEEFGQPKSGDAAPA
ADASPSLNREEVMKLLSIFESRLSFLLLQSIKLLSSTKKKTSNNIEDDAVLKTNKHIYSQ
LLRATANKTATLLERINVIVHLLGQLAAGSAASSSAVQ
Download sequence
Identical sequences A0A096NBV8
ENSPANP00000010263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]