SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010268 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010268
Domain Number 1 Region: 218-316,344-567
Classification Level Classification E-value
Superfamily NHL repeat 1.33e-29
Family NHL repeat 0.0046
Further Details:      
 
Domain Number 2 Region: 73-187
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.73e-21
Family Glutathione peroxidase-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010268   Gene: ENSPANG00000020749   Transcript: ENSPANT00000024708
Sequence length 730
Comment pep:known_by_projection chromosome:PapAnu2.0:9:105498124:105550563:1 gene:ENSPANG00000020749 transcript:ENSPANT00000024708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPGSRGRSLSGLLPAQTSLEYALLDAVTQQEKDSLVYQYLQKVDCWEQDLSVPEFPEG
LEWLNTEEPISVYKDLCGKIVILDFFTYCCINCIHLLPDLHALEHTYSDKDGLLIIGVHS
AKFPNEKVLDNIKSAVLRYNITHPVVNDADASLWQELEVSCWPTLVILGPRGNMLFSLIG
EGHKDKLFLYTSIALKYYKDRGQIRDDKIGIKLYKDSLPPSPLLFPGKVTVDQVTNRLVI
ADTGHHRILVVWKNGQIQYSIGGPNPGRKDGIFSESTFNSPQGVAIMNNIIYVADTENHL
IRKRGYQEMKAEHIFPVEYISFQFMKKEINALGCLLPELSPWWSVTLPQEGSEVQRGDIL
WIAMAGTHQIWALLLDSGKLPKKNELTKGTCLRFAGSGNEENRNNAYPHKAGFAQPSGLS
LASEDPWSCLFVADSESSTVRTISLKDGAVKHLVGGERDPMNLFAFGDVDGVGINAKLQH
PLGVTWDKKRNLLYVADSYNHKIKVVDPKTKNCTTLAGTGDTNNVTSSSFTESTFNEPGG
LCIGENGQLLYVADTNNHQIKIMDLETKMVSVLPIFRSENAVVDGPFLVEKQKTLPKLPK
SAPSIRLSPVTVCAGQTLQFKLRLDLPSGSKLTEGVPSCWFLRAEGNEWLLQGQMPSGDI
ENISSQPTISLQIPDDCLSLEAIVSVSVFLYYCSADSSACMMKAILFSQPLQITDTQQGC
IAPVELRYVF
Download sequence
Identical sequences ENSPANP00000010268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]