SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010290 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010290
Domain Number 1 Region: 348-709
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 3.14e-119
Family Oxysterol-binding protein 0.0000102
Further Details:      
 
Domain Number 2 Region: 3-107
Classification Level Classification E-value
Superfamily PH domain-like 1.31e-19
Family Pleckstrin-homology domain (PH domain) 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010290   Gene: ENSPANG00000005884   Transcript: ENSPANT00000027411
Sequence length 715
Comment pep:known_by_projection chromosome:PapAnu2.0:1:53792107:53953008:1 gene:ENSPANG00000005884 transcript:ENSPANT00000027411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASIMEGPLSKWTNVMKGWQYRWFVLDYNAGLLSYYTSKDKMMRGSRRGCVRLRGAVIGI
DDEDDSTFTITVDQKTFHFQGDFIDARDADEREKWIHALEETILRHTLQLQGLDSGFVPS
VQDFDKKLTEADAYLQILIEQLKSMVESIKHCIVLLQIAKDQSNVEKHADGMISTINPVD
AIYQPSPLEPVISTMPSQTVLPPEPVQLCKSEQRPSSLPVGPVLATLGHHQTPTPNSTGS
GHSPPSSSLTSPSHVNLSPNTVPEFSYSSSEDEFYDADEFHQSGSSPKRLIDSSGSASVL
THSSSGNSLKRPDTTESLNSSMSNGTSDADLFDSHDDRDDDAEAGSVEEHKSVIMHLLSQ
VRLGMDLTKVVLPTFILERRSLLEMYADFFAHPDLFVSISDQKDPKDRMVQVVKWYLSAF
HAGRKGSVAKKPYNPILGEIFQCHWTLPNDTEENTELVSEGPVPWVSKNSVTFVAEQVSH
HPPISAFYAECFNKKIQFNAHIWTKSKFLGMSIGVHNIGQGCVSCLDYDEHYILTFPNGY
GRSILTVPWVELGGECNINCSKTGYSANIIFHTKPFYGGKKHRITAEIFSPNDKKSFCSI
EGEWNGVMYAKYATGENTVFVDTKKLPIIKKKVRKLEDQNEYESRSLWKDVTFNLKIRDI
DAATEAKHRLEERQRAEARERKEKEIQWETRLFHEDGECWVYDEPLLKRLGAAKH
Download sequence
Identical sequences ENSPANP00000010290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]