SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010361 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010361
Domain Number 1 Region: 41-205
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.88e-26
Family Adenylyl and guanylyl cyclase catalytic domain 0.0016
Further Details:      
 
Domain Number 2 Region: 303-464
Classification Level Classification E-value
Superfamily Nucleotide cyclase 5.49e-22
Family Adenylyl and guanylyl cyclase catalytic domain 0.0026
Further Details:      
 
Domain Number 3 Region: 1077-1166
Classification Level Classification E-value
Superfamily TPR-like 0.0000321
Family Tetratricopeptide repeat (TPR) 0.04
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000010361
Domain Number - Region: 490-552,644-681
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0045
Family Nucleotide and nucleoside kinases 0.077
Further Details:      
 
Domain Number - Region: 1313-1447
Classification Level Classification E-value
Superfamily TPR-like 0.0114
Family Tetratricopeptide repeat (TPR) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010361   Gene: ENSPANG00000010285   Transcript: ENSPANT00000005830
Sequence length 1616
Comment pep:known_by_projection chromosome:PapAnu2.0:1:190741519:190829317:-1 gene:ENSPANG00000010285 transcript:ENSPANT00000005830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTPREEFQDWPIVRIAAHLPDLIVYGHFSPERPFIDSFDGVLMFVDISGFTAMTEKFSS
AMYMDKGAEQLVEILNYHISAIVEKVLIFGGDILKFAGDALLALWRVERKQLKNIITVAI
KCSLEIHGLFETQESEEGLDIRVKIGLAAGHISMLVFGDETHSHFLVIGQAVDDVRLAQN
MAQMNDVILSPNCWQLCDRSMIEIESIPDQRAVKVNFLKPPSSFKFDEFFTKCMTFMNYY
PSGKHKNLLRLVCTLKPDPELEMSLQKYVMESILKQIDDKQLQGYLSELRPVTTVFVNLM
FEDQDKAEEIGPAIQDAYIHITSVLKIFQGQINKVFMFDKGCSFLCIFGFPGEKVPDELT
HALECAMDIFDFCSQVHKIQTVSIGVASGIVFCGIVGHTVRHEYTVIGQKVNIAARMMMY
YPGIVTCDSVTYNGSNLPAYFFKELPKKVMKGVGDSGPLYQYLGHTEKVMFGMACLICNR
KEDYPLLELKITGRNKEINYFMCIMKKFLMSNSSQVLMYEGLPGYGKSQILTKIKYLAQG
ENHRNRVIAISLTKISFHQTFYTIQMLMVNVLGLDTCKHYKERQTNLQNKVMTLLDEKFY
CLLNDIFHVQFPISREISRMSTLKKQNQLEVLFMKILEQTVKEEWIVFIIHEAQFVDSTS
WRFMEKLIRTLPIFIIMSLCPFIDIPCAAASAIMKNRNTTYITVGAVQPNDVTNKICLDL
NVSCIPKELDLYLVEGSCGIPFYCEELLKNLEHHKVLVFQQTESEEKTNRTWNNLFKYFI
KPIERLNMVTLQSDEESEVCHLASGVRLKNLSPPTSLKEISLIQLDSMSLSHQMLVRCAA
IIGLTFTTELLFEILPCWNMKMMIKALATLVESNIFHCFRNGKELQNALKQNDTSFEVHY
RSLSLKPSEEMDHGEEEELRELENEVIECHRIRFCSPMMQKTAYELWLKDQRKAMHLKCA
RFLEEDAHRCDHCRSKDFIPYHHFTVNIRLNTLDMDAIKKMATSHGFGTQEDLILSKSEI
PETSALFPENPSPDKIREKILNFFDDVLTKMKTSDEDIIPLESCQCEEILEIVILPLAHH
FLALGENNKALYYFLEIASAYLILHDNYMAYMYLNEGEKLLKTLEKDKSWSQTFESATFY
SLKGEVCFNMGQIALAKKMLRKALKLLNRIFPYNLISLFLHIRIEKNRHFHYVNQQAQDS
PPPGKKRLAQLYRQTVCLSLLWRIYSYGYFFHWKYYAQLAVMMQMNTALETQNHFQIIKA
YLDYSLYHHLAGYQGVWFKYEVMAMEQIFNLPLKGEGIEIVAYVAETLVFNKFIMGHLDL
AIELGSRALQMWALLQNTNQHYLSLCRLSRCLLLNSRYPQLIQVLGRLWELSETQEHVLS
KAFFYFICLDILLYSGWTYRAEESFLNSCVQSQTVQWWLILPGCFQGFYSSQVIKYARLQ
EWDNFYIFSNRAKNLLPRRTMTIIYYDGISRYMEGQILHLQRQIKEQSDNAQASGEELLK
NLENLVAQNTIGPVFCPRLYHLMAYICILMGDGQKCGVFLNTALRLSETQGNMLEKCWLN
MSKEWWYSTSELKEEQWFQTILSLPSWEKIVAGRVNIQDLQKNKFQMRANTVDNHF
Download sequence
Identical sequences ENSPANP00000010361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]