SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010388 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010388
Domain Number 1 Region: 607-803
Classification Level Classification E-value
Superfamily PUA domain-like 4.47e-38
Family LON domain-like 0.0091
Further Details:      
 
Domain Number 2 Region: 243-350
Classification Level Classification E-value
Superfamily TPR-like 3.6e-24
Family Tetratricopeptide repeat (TPR) 0.0026
Further Details:      
 
Domain Number 3 Region: 515-584
Classification Level Classification E-value
Superfamily RING/U-box 4.37e-17
Family RING finger domain, C3HC4 0.0057
Further Details:      
 
Domain Number 4 Region: 151-200
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000278
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000010388
Domain Number - Region: 69-112
Classification Level Classification E-value
Superfamily TPR-like 0.0569
Family Tetratricopeptide repeat (TPR) 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010388   Gene: ENSPANG00000015252   Transcript: ENSPANT00000010173
Sequence length 811
Comment pep:known_by_projection chromosome:PapAnu2.0:X:107476471:107522173:1 gene:ENSPANG00000015252 transcript:ENSPANT00000010173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESLRTEQMLSLPAEVSSNNLEPAERGASAAQVDMGPHREAAAESPAPLPTREPEQDQSP
GTSTPESKVLLTQADALASRGRIREALEVYRQLSERQQLVAEQLEQLVRCLAEKVPQGEV
LAPAPPGEGSTASGAVAAEEIGAAAAAAATEVWDGFKCRKCHGFLSDPVSLSCGHTFCKL
CLERGRAADRRCALCGVKLSALMVATGRARGSRRAGQQPPPPLRVNVVLSGLLGKLFPGP
ARASQLRHEGNRLYRERQVEAALLKYNEAVKLAPNDHLLYSNRSQIYFTLESHENALHDA
EIACKLRPMGFKAHFRKAQALATLGKVEEALREFLYCVSLDGKNKRARCEAQRLLLSFFS
PSVPGDSQEHSPDILKLLAPHPRLKENVESMTTEVTSHNLPRLLQDNLELPHCSSQEEAA
ARGDGSSLMDPAKVKGDGQQHHMKDQEEEEEKWDATSPKAASSKTGKCQEKKRKHCQIES
QEDTGMPNKASKQDPPTDQGDTPALSLPLASFDASDLECALCMRLFYEPVTTPCGHTFCL
KCLERCLDHNAKCPLCKDGLSQCLASRKYSKNVIMEELIAKFLPEELKERRKLYEEEMEE
LSNLNKNVPIFVCTMAYPTVPCPLHIFEPCYRLMIRRCIETGTRQFGMCLGDPVKGFAEY
GCILEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIEDQKVQGEDCAELM
GLHNCVYQQASLWFHSLKSSLKNRILNHFGPMPEKDADPQMNPNGPAWCWWMLAVLPLES
RAQLPFLAMRSLKDRLNGIRRVLAFISRNQN
Download sequence
Identical sequences A0A096NC58
ENSPANP00000010388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]