SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010399 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010399
Domain Number 1 Region: 234-320
Classification Level Classification E-value
Superfamily SH2 domain 1.38e-47
Family SH2 domain 0.0000127
Further Details:      
 
Domain Number 2 Region: 10-147
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 1.06e-41
Family N-terminal domain of cbl (N-cbl) 0.00034
Further Details:      
 
Domain Number 3 Region: 327-404
Classification Level Classification E-value
Superfamily RING/U-box 4.16e-39
Family RING finger domain, C3HC4 0.00015
Further Details:      
 
Domain Number 4 Region: 149-233
Classification Level Classification E-value
Superfamily EF-hand 4.42e-38
Family EF-hand modules in multidomain proteins 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010399   Gene: ENSPANG00000007942   Transcript: ENSPANT00000017968
Sequence length 474
Comment pep:known_by_projection chromosome:PapAnu2.0:19:38319178:38342368:1 gene:ENSPANG00000007942 transcript:ENSPANT00000017968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVAVAPWGRQWEEARALGRAVRMLQRLEEQCSDPRLSLSPPSLRDLLPRTAQLLREVAR
AQRAAGRGGPGGPGGSRDFLLVYLANLEAKSRQLGALLPPRGRRSANDELFRAGSSLRRQ
LAKLAIIFSHMHAELHALFPGGKYCGHVYQLTKAPAHIFWRERCGARCVLPWAEFESLLG
TCHPVEPGCTALALRTTIDLTCSGHVSIFEFDVFTRLFQPWPTLLKNWQLLAVNHPGYMA
FLTYDEVQERLQACRDKPGSYIFRPSCTRLGQWAIGYVSSDGSILQTIPANKPLSQVLLE
GQKDGFYLYPDGKNHNPDLTELDQAEAQQRIHVSEEQLQLYWAMNSTFELCKICAESNKD
VKIEPCGHLLCSRCLAAWQHSDSQTCPFCRCKIKGWEAVSIYEFHGQATAEDSEDGSDQE
GRELELEQAPILAPQLPPRPDLPPRKPRNAQPKVRLLKGNSPPAALGPQDPAPA
Download sequence
Identical sequences ENSPANP00000010399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]