SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010400 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010400
Domain Number 1 Region: 286-464
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.46e-49
Family BCR-homology GTPase activation domain (BH-domain) 0.00000324
Further Details:      
 
Domain Number 2 Region: 2-186
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.45e-40
Family BAR domain 0.0074
Further Details:      
 
Domain Number 3 Region: 160-261
Classification Level Classification E-value
Superfamily PH domain-like 2.75e-16
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010400   Gene: ENSPANG00000008805   Transcript: ENSPANT00000012833
Sequence length 702
Comment pep:known_by_projection chromosome:PapAnu2.0:X:59658462:59877828:-1 gene:ENSPANG00000008805 transcript:ENSPANT00000012833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHNASDLLIKPLENFRKEQIGFTKERKKKFEKDGERFYSLLDRHLHLSSKKKESQLQEA
DLQVDKERHNFFESSLDYVYQIQEVQESKKFNIVEPVLAFLHSLFISNSLTVELTQDFLP
YKQQLQLSLQNTRNHFSSTREEMEELKKRMKEAPQTCKLPGQPTIEGYLYTQEKWALGIS
WVKYYCQYEKETKTLTMTPMEQKPGAKQGPLDLTLKYCVRRKTESIDKRFCFDIETNERP
GTITLQALSEANRRLWMEAMDGKEPSYHSAYSKLETVELNEVGFKFVRKCINIIETKVGI
KTEGLYRTVGSNIQVQKLLNAFFEIDPKCPGDVDFHNSDWDIKTITSSLKFYLRNLSEPV
MTYRLHKELVSAAKSDNLDYRLGAIHSLVYKLPEKNREMLELLIRHLVNVCEHSKENLMT
PSNMGVIFGPTLMRAQEDTVAAMMNIKFQNIVVEILIEHFGKIYLGPPEESAAPPVPPPR
VTARRHKPITISKRLLRERTVFYTSSLDESEDEIQHQTPNGTITGSIETPKPPQHPKLPI
QRSGETDPGRKSPSRPISDGKLEPCPEVDVGKLVSRLQDGGTKITPKATNGPMPGSGPTK
TPSFHIKRPAPRPLAHHKEGDADSFSKVRPPGEKPTIIRPPVRPPDPPCRAATPQKPEPK
PDIVAGNAGEITSSVVASRTRFFETASRKTGSSQGRLPGDES
Download sequence
Identical sequences ENSPANP00000010400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]