SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010403 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010403
Domain Number 1 Region: 400-672
Classification Level Classification E-value
Superfamily SAICAR synthase-like 5.23e-94
Family Inositol polyphosphate kinase (IPK) 0.00000000866
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010403   Gene: ENSPANG00000013321   Transcript: ENSPANT00000006233
Sequence length 674
Comment pep:known_by_projection chromosome:PapAnu2.0:19:35007272:35035386:1 gene:ENSPANG00000013321 transcript:ENSPANT00000006233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRCPCRGSLSEAEAGALPVAARLGLEAPRGGRRRQPGQQRPGPGAGAPAGRPEGGGPWA
RTEGSSLHSEPERAGLGPAPGTESSQTEFWTDGQTEPSAAGLGVETERAKQKTEPDRSSL
RTHPERSWSELETTCPWTEAGTDGLWTDPRRSDLQFQPGEASPWTELETHGSQTQPERVK
SWADNLWTHQNSSNLQTHPEGACPSKEPSADGSWKELYTDGSRTQQDIEGPWTEPYTDGS
QKKQDTETARKQPGTGGFQTQQDTDGSWTQPSTDGSQTAPGTDCLLGEPEDGPLEEPEPG
ELVTHLYSDLKCSPLCPVPRLIITPETPEPEAQSVGPPSRVEGGSGGFSSASSFDESEDD
VVAGGGGASDPEDRSGSKPWKKLKTVLKYSPFVVSFRKHYPWVQLSGHAGNFQAGEDGRI
LKRFCQCEQRSLEQLMKDPLRPFVPAYYGMVLQDGQTFNQMEDLLADFEGPSIMDCKMGS
RTYLEEELVKARERPRPRKDMYEKMVAVDPGAPTPEEHAQGAVTKPRYMQWRETMSSTST
LGFRIEGIKKADGTCNTNFKKTQALEQVTKVLEDFVDGDHIILQKYVARLEELREALEIS
PFFKTHEVVGSSLLFVHDHTGLAKVWMIDFGKTVALPDHQTLSHRLPWAEGNREDGYLWG
LDNMICLLQGLAQS
Download sequence
Identical sequences A0A0A0MWV8
ENSPANP00000010403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]