SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010406 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010406
Domain Number 1 Region: 560-709
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.16e-66
Family Ankyrin repeat 0.00000175
Further Details:      
 
Domain Number 2 Region: 53-290,322-347
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.88e-65
Family BAR domain 0.0016
Further Details:      
 
Domain Number 3 Region: 438-555
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 7.59e-39
Family Pyk2-associated protein beta ARF-GAP domain 0.0000053
Further Details:      
 
Domain Number 4 Region: 313-431
Classification Level Classification E-value
Superfamily PH domain-like 5.51e-20
Family Pleckstrin-homology domain (PH domain) 0.0083
Further Details:      
 
Domain Number 5 Region: 1053-1127
Classification Level Classification E-value
Superfamily SH3-domain 9.06e-16
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010406   Gene: ENSPANG00000024473   Transcript: ENSPANT00000009339
Sequence length 1129
Comment pep:known_by_projection chromosome:PapAnu2.0:8:124984292:125333164:-1 gene:ENSPANG00000024473 transcript:ENSPANT00000009339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSSASRLSSFSSRDSLWNRMPDQISVSEFIAETTEDYNSPTTSSFTTRLHNCRNTVTLL
EEALDQDRTALQKVKKSVKAIYNSGQDHVQNEENYAQVLDKFGSNFLSRDNPDLGTAFVK
FSTLTKELSTLLKNLLQGLSHNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKI
EKEKREHAKQHGMIRTEITGAEIAEEMEKERRLFQLQMCEYLIKVNEIKTKKGVDLLQNL
IKYYHAQCNFFQDGLKTADKLKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLD
QKEDSQSRQGGYSMHQLQGNKEYGSEKKGYLLKKSDGIRKVWQRRKCSVKNGILTISHAT
SNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYVAWISVLTNSKEEALT
MAFRGEQSAGENSLEDLTKAIIEDVQRLPGNDICCDCGSSEPTWLSTNLGILTCIECSGI
HREMGVHISRIQSLELDKLGTSELLLAKNVGNNSFNDIMEANLPSPSPKPTPSSDMTVRK
EYITAKYVDHRFSRKTCSTSSAKLNELLEAIKSRDLLALIQVYAEGVELMEPLLEPGQEL
GETALHLAVRTADQTSLHLVDFLVQNCGNLDKQTALGNTVLHYCSMYSKPECLKLLLRSK
PTVDIVNQAGETALDIAKRLKATQCEDLLSQAKSGKFNPHVHVEYEWNLRQEEMDESDDD
LDDKPSPIKKERSPRPQSFCHSSSISPQDKPALPGFSTPRDKQRLSYGAFTNQIFVSTST
DSPTSPTTEAPPLPPRNAGKGPTGPPSTLPLSTQTSSGSSTLSKKRPPPPPPGHKRTLSD
PPSPLPHGPPNKGAVPWGNDGGPSSSSKTTNKFEGLSQQSSTSSAKTALGPRVLPKLPQK
VALRKTDHLSLDKSNIPPEIFQKSSQLAELPQKPPPGDLPPKPTELAPRPQVGDLPPKPG
ELPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQTGDVSPKAQQPSEVTPK
SHPLDLSPNVQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDCQA
DNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD
Download sequence
Identical sequences A0A096NC67 A0A2K5LPP1
ENSPANP00000010406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]