SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010410 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010410
Domain Number 1 Region: 7-254
Classification Level Classification E-value
Superfamily TPR-like 2.28e-47
Family Tetratricopeptide repeat (TPR) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010410   Gene: ENSPANG00000016946   Transcript: ENSPANT00000018244
Sequence length 312
Comment pep:known_by_projection chromosome:PapAnu2.0:18:3005981:3036240:-1 gene:ENSPANG00000016946 transcript:ENSPANT00000018244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLR
EAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALER
AGKLIENVDPEKAVQLYQQTANVFENEERLRQAVELLGKASRLLVRGRRFDEAALSIQKE
KNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGFNGSEDCAALEQLLE
GYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSPATPQAKPDGVTATAA
DEEEDEYSGGLC
Download sequence
Identical sequences A0A096NC71 A0A0D9RY84 A0A2I3GQH1 A0A2K5CX41 A0A2K5LGY7 A0A2K5PG65 A0A2K6T7R3 F7IPU4 G3RHC2 H2QE91 K7ET77 Q6FHY4 Q99747
ENSPANP00000010410 ENSGGOP00000015040 9606.ENSP00000324628 ENSNLEP00000008497 NP_003817.1.87134 NP_003817.1.92137 XP_002757095.1.60252 XP_003262132.1.23891 XP_003809382.1.60992 XP_003924902.1.74449 XP_004059235.1.27298 XP_007972862.1.81039 XP_011901357.1.92194 XP_011901358.1.92194 XP_011901359.1.92194 XP_012302300.1.9421 XP_017369662.1.71028 XP_523864.3.37143 ENSNLEP00000008497 ENSCJAP00000008396 ENSCJAP00000008396 ENSPPYP00000023746 ENSP00000324628 ENSP00000324628 ENSGGOP00000015040 ENSP00000324628 ENSPPYP00000010101 gi|4505331|ref|NP_003817.1| ENSPTRP00000016784 ENSPTRP00000016784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]