SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010441 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010441
Domain Number 1 Region: 201-353
Classification Level Classification E-value
Superfamily PH domain-like 8.3e-33
Family Third domain of FERM 0.0015
Further Details:      
 
Domain Number 2 Region: 3-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.93e-21
Family First domain of FERM 0.0029
Further Details:      
 
Domain Number 3 Region: 89-199
Classification Level Classification E-value
Superfamily Second domain of FERM 2.49e-20
Family Second domain of FERM 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000010441
Domain Number - Region: 439-502
Classification Level Classification E-value
Superfamily Prefoldin 0.0889
Family Prefoldin 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010441   Gene: ENSPANG00000022151   Transcript: ENSPANT00000020062
Sequence length 984
Comment pep:known_by_projection chromosome:PapAnu2.0:2:65901992:66109128:1 gene:ENSPANG00000022151 transcript:ENSPANT00000020062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEGRHCQVHLLDDRRLELLVQPKLLARELLDLVASHFNLKEKEYFGITFIDDTGQQNWL
QLDHRVLDHDLPKKPGPTVLHFAVRFYIESISFLKDKTTVELFFLNAKACVHKQQGQIEV
DSETIFKLAAFVLQEAKGDYTSDENARKDLKTLPAFPTKTLQEHPSLAYCEDRVIEHYLK
IKGLTRGQAVVQYMKIVEALPTYGVHYYAVKDKQGLPWWLGISYKGIGQYDIQDKVKPRK
LFQWKQLENLYFREKKFAVEVHDPRRISVSRRTFGQSGLFVQTWYANSSLIKSIWVMAIS
QHQFYLDRKQSKAKIPSARSLDEIAMDLTETGTQRASKLVTLEAKSQFIMTSNGSLISSG
SQDSEVSEEQKREKILELKKKEKLLQEKLLKKVEELKKICLREAELTGKMPKEYPLNVGE
KPPQVRRRVGTAFKLDDNLLPSEEDPALQELESNFLIQQKLVEAAKKLANEPDLCKTVKK
KRKQDYTDAVKKLQEIENAINEYRIRCGKKPSQKAAVLPEDIIPSESSSLSDTTTFDDPS
DAFTLAGQRSSSVPHSPRILPPKSLGIERIHFRKSSINEQFVDTRQSREMLSTHSSPYKT
LERRPQGGRSMPTTPVLTRNAYSSSHLEPESSSQHCRQRSGSLESQSHLLSEMDSDKPFF
SLSKSQRSSSTEILDDGSSYTSQSSTEYYCVTPVTGPYYTTQTLDTRTRGRRRSKKQNVS
TSNSGSMPNLAQKDSLRNGVYSKSQEPPSSSYYIAGYTPYAECDFYYSGSYVYENDTEGQ
YSVNPSYRSSAHYGYERQRDYSRSFHEDEVDRVPHNPYATLRLPRKAAAKSEHITKNIHK
ALVAEHLRGWYQRATGQKDQGHSLQTSFDSDRGSQRCLGFAGLQVPCSPSSRASSYSSAV
SSTNASGNWRTQLTIGLSDYETPAHSSYTSCYGNVYNPLPSPSSRQYTEISQLDGTDGNR
LEDSLESSEQRLFWHEDSKPGTLV
Download sequence
Identical sequences ENSPANP00000010441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]