SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010457 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010457
Domain Number 1 Region: 403-488
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.02e-23
Family Canonical RBD 0.003
Further Details:      
 
Domain Number 2 Region: 29-67
Classification Level Classification E-value
Superfamily SAP domain 0.000000011
Family SAP domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010457   Gene: ENSPANG00000007004   Transcript: ENSPANT00000013352
Sequence length 953
Comment pep:known_by_projection chromosome:PapAnu2.0:19:5347942:5385862:-1 gene:ENSPANG00000007004 transcript:ENSPANT00000013352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETLPGSGDSGPGTAALGPGVAETGTRRLSELRVIDLRAELKKRNLDTGGNKSVLMERL
KKAVKEEGQDPDEIGIELEASSKKSAKRCVKGLKMEEEGTEDNGLEDDSRDGQEDMEASL
ENLQNMGMMDMSVLDETEVENSSAPDFGEDGADSLLDSFCDSKEYVAAQLRQLPAQLPEH
AVDGEGFKNTSETSSLNFKVTPDIEESLLEPENEKILDILGETCKSEPVKEESSELEQPF
AQDTSSVGPDRKLAEEEDLFDSAHPEEGDLDLASESTAHAQSSKADSLLAVVKREPAEQP
GDGERTDCEPVGLEPAVEQSSAASELAEASSEELAEAATEAASPEARDSKEDGRKFDFEA
CNEVPPAPKESSTSEGADQKMSSFKEEKDIKPIIKDEKGRVGSSSGRNLWVSGLSSTTRA
TDLKNLFSKYGKVVGAKVVTNARSPGARCYGFVTMSTSDEATKCISHLHRTELHGRMISV
EKAKNEPAGKKLSDRKECEVKKEKLSSVDRHHSVEIKIEKTVIKKEEKIEKKEEKKPEDI
KKEEKDQDELKPGPTSRSRVTKSGSRGMERTVVMDKSKGEPVISVKTTSRSKERSSKSQD
RKSESKEKRDILSFDKIKEQRERERQRQREREIRETERRREREQREREQRLEAFHERKEK
ARLQRERLQLECQRQRLERERMERERLERERMRVERERRKEQERIHREREELRRQQEQLR
YEQERRPGRRPYDLDRRDDAYWPEGKRVAMEDRYRADFPRPDHRFHDFDHRDRGQYQDHA
IDRREGSRPMMGDHRDGQHYGDDRHGHGGPPERHGRDSRDGWGGYGSDKRLSEGRGLPPP
PRGGRDWGEHNQRLEEHQARAWQGTMDAGAASREHARWQGGERGLSGPSGPGHMASRGGV
AGRGGFAQGGHSQGHVVPGGGLEGGGVASQDRGSRVPHPHPHPPPYPHFTRRY
Download sequence
Identical sequences A0A0A0MWW1
ENSPANP00000010457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]