SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010460 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010460
Domain Number 1 Region: 104-313
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-54
Family DBL homology domain (DH-domain) 0.0000597
Further Details:      
 
Domain Number 2 Region: 324-447
Classification Level Classification E-value
Superfamily PH domain-like 1.56e-19
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010460   Gene: ENSPANG00000001100   Transcript: ENSPANT00000002111
Sequence length 526
Comment pep:known_by_projection chromosome:PapAnu2.0:2:78497571:78571657:1 gene:ENSPANG00000001100 transcript:ENSPANT00000002111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAKDYPFYLTVKRANCSLELPPASGPAKDAEEPSNKRVKPLSRVTSLANLIPPVKATPL
KRFSQTLQRSISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQMLTSKE
IKRQEAIFELSQGEEDLIEDLKLAKKAYHDPMLKLSIMTEQELNQIFGTLDSLIPLHEEL
LSQLRDVRKPDGSTEHVGPILVGWLPCLSSYDSYCSNQVAAKALLDHKKQDHRVQDFLQR
CLESPFSRKLDLWNFLDIPRSRLVKYPLLLREILRHTPNDNPDQQHLEEAINIIQGIVAE
INTKTGESECRYYKERLLYLEEGQKDSLIDSSRVLCCHGELKNNRGVKLHVFLFQEVLVI
TRAVTHNEQLCYQLYRQPIPVKDLLLEDLQDGEVRLGGSLRGAFSNNERIKNFFRVSFKN
GSQSQTHSLQANDTFNKQQWLNCIRQAKETVLCAAGQAGVLDSEGSFLNPTTGSRELQGE
TKLEQMDQSDSESDCSMDTSEVSLDCEHMEQTDSSCGNSRHGESNV
Download sequence
Identical sequences A0A096NCB8 A0A2K5KN24 A0A2K6B8U0 H9FV28 Q9N0A8
ENSPANP00000010460 XP_001101312.2.72884 XP_005547498.1.63531 XP_011741004.1.29376 XP_011914984.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]