SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010474 from Papio anubis 76

(show help)
Strong hits

Sequence:	ENSPANP00000010474
Domain Number 1	Region: 75-137
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	6.21e-17
Family	LIM domain	0.0011
Further Details:

Domain Number 2	Region: 256-319
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	2.64e-16
Family	LIM domain	0.001
Further Details:

Domain Number 3	Region: 198-259
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	4.95e-16
Family	LIM domain	0.0016
Further Details:

Domain Number 4	Region: 162-196
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0000000000000343
Family	LIM domain	0.00044
Further Details:

Domain Number 5	Region: 38-72
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0000000000157
Family	LIM domain	0.00091
Further Details:

Domain Number 6	Region: 133-164
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0000000000917
Family	LIM domain	0.0009
Further Details:

Weak hits

Sequence:	ENSPANP00000010474
Domain Number -	Region: 315-344
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0214
Family	LIM domain	0.025
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

External link(s)	Protein: ENSPANP00000010474 Gene: ENSPANG00000017633 Transcript: ENSPANT00000027936
Sequence length	362
Comment	pep:known_by_projection chromosome:PapAnu2.0:13:99837093:99902195:1 gene:ENSPANG00000017633 transcript:ENSPANT00000027936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MTALQLKELSHSGLYRRRRDRPDSLRVNGLPEEELSNMANALASATCERCKGGFAPAEKI VNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPCCHQCGEFIIGRVI KAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIID EQPLIFKNDPYHPDHFNCANCGKELTADARELKGELYCLPCHDKMGVPICGACRRPIEGR VVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYNQLFGDVCFHCNRVIEGDV VSALNKAWCVNCFACSTCNTKLTLKNKFVEFDMKPVCKKCYEKFPLELKKRLKKLAETLG RK
Download sequence
Identical sequences	A0A096NCD2 A0A2K5HAQ3 A0A2K5MBU3 A0A2K5U288 A0A2K6B1U3 A0A2K6K4C0 A0A2K6PH99 F7GXP0 ENSPANP00000010474 ENSP00000387264 NP_001180413.1.87134 NP_001180413.1.92137 XP_002799413.1.72884 XP_005575275.1.63531 XP_008006512.1.81039 XP_010367023.1.97406 XP_011722918.1.29376 XP_011816860.1.43180 XP_011927041.1.92194 XP_017739290.1.44346 ENSP00000387264 ENSMMUP00000036176 gi\|301601609\|ref\|NP_001180413.1\|

SEARCH