SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010516 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010516
Domain Number 1 Region: 1280-1378
Classification Level Classification E-value
Superfamily PH domain-like 1.76e-25
Family Pleckstrin-homology domain (PH domain) 0.002
Further Details:      
 
Domain Number 2 Region: 38-135
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.03e-20
Family FHA domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000010516
Domain Number - Region: 725-857,1281-1301
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0146
Family BAR domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010516   Gene: ENSPANG00000012219   Transcript: ENSPANT00000020004
Sequence length 1389
Comment pep:known_by_projection chromosome:PapAnu2.0:14:107965272:108011978:1 gene:ENSPANG00000012219 transcript:ENSPANT00000020004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTLNRNQIGPGCKTQTMVQKGPLDLIETGKGLKVQTDKPHLVSLGSGRLSTAITLLPLE
EGRTVIGSAARDISLQGPGLAPEHCYIENLRGTLTLYPCGNACTIDGLPVRQPTRLTQGC
MLCLGQSTFLRFNHPAEAKWMKSMIPAGGRAPGPPYSPVPAESESLVNGNHTPQPATRGP
SACASHSSLVSSIEKDLQEIMDSLVLEEPGAAGKKPATTSPLSPMANASSGSCASHSPSG
QEPGPSVPPLVPARSSSYHLALQPPQSRPSGARSESPRLSRKGGHERPPSPGLRGLLTDS
PAATVLAEARRATESPRLGGQLPVVAISLSEYPASGALSQPTSIPGSPKFQPPVPAPRNK
IGTLQDRPPSPFREPPGSERVLTTSPSRQLVGRTFSDGLATRTLQPPESPRLGRRGLDSM
RELPPLSPSLSRRALSPLPTRTTPDPKLSREVAESPRPRRWAAHGASPEDFSLTLGARGR
RTRSPSPTLGESLAPRKGSFSGRLSPAYSLGSLTGASPCQSPCVQRKLSSGDLRVPVTRE
RKNSITEISDNEDDLLEYHRRQRQERLREQEMERLERQRLETILNLCAEYSRADGGSEAG
ELPSIGEATVALALAGRRPSRGLAGASGRSSEEPGIATQRLWESMERSDEENLKEECSST
ESTQQEHEDTPSTKLQGEVLALEEERAQVLGRVEQLKVRVKELEQQLQESAREAEMERAL
LQGEREAERALLQKEQKAVDQLQEKLVALETGIQKERDKEAEALETETKLFEDLEFQQLE
RESRVEEERELAGQGLLRSKAELLRSITKRKERLAVLDSQAGQIRAQAVQESERLARDKN
ASLQLLQKEKEKLTVLERRYHSLTGGRPFPKTTSTLKEYVMLEQLKVMRDTSPMPPAPVP
GLSPWASASRDLVPTTCLPPMLPSSSFASITPSPKMEKLLLPAVDLEQWYQELMAGLGTG
PTAASPHSSPPPLPAKASRQLQVYRSKMDGEATSPLPRTRSGPLPSSSGSSSSSSQLSVA
TLGRSPSPKSALLTQNGTGSLPRNLAATLQDIETKRQLALQQKGQQVIEEQRRRLAELKQ
KAAAEAQCQWDALHGAAPFPAGPSGFPTLMHHSILHHLPAGRERGEEGEHAYDTLSLESS
DSMETSISTGGNSACSPDNMSSASGLDMGKIEEMEKMLKEAHAEKNRLMESREREMELRR
QALEEERRRREQVERRLQSESARRQQLVEKEVKMREKQFSQARPLTRYLPIRKEDFDLKT
HIESSGHGVDTCLHVVLSSKVCRGYLVKMGGKIKSWKKRWFVFDRLKRTLSYYVDKHETK
LKGVIYFQAIEEVYYDHLRSAAKSPNPALTFCVKTHDRLYYMVAPSAEAMRIWMDVIVTG
AEGYTQFMN
Download sequence
Identical sequences ENSPANP00000010516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]