SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010536 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010536
Domain Number 1 Region: 6-302
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.81e-51
Family BAR domain 0.000000958
Further Details:      
 
Domain Number 2 Region: 278-373
Classification Level Classification E-value
Superfamily PH domain-like 1.46e-23
Family Pleckstrin-homology domain (PH domain) 0.0000132
Further Details:      
 
Domain Number 3 Region: 471-613
Classification Level Classification E-value
Superfamily PH domain-like 1.81e-21
Family Phosphotyrosine-binding domain (PTB) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010536   Gene: ENSPANG00000012253   Transcript: ENSPANT00000022537
Sequence length 663
Comment pep:known_by_projection chromosome:PapAnu2.0:11:104410665:104467072:-1 gene:ENSPANG00000012253 transcript:ENSPANT00000022537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAVDKLLLEEALQDSPQTRSLLSVFEEDAGTLTDYTNQLLQAMQRVYGAQNEMCLATQQ
LSKQLLAYEKQNFALGKGDEEVISTLHYFSKVVDELNVLHTELAKQLADTMVLPIIQFRE
KDLTGKVDIKVVFQEAKTCLLQSSANYSVLTECLTFNQVKTEVGKEVAAARRKQHLSSLQ
YYCALNALQYRKRMAMMEPMIGFAHGQINFFKKGAEMFSKHMDSFLSSVADMVQSIQVEL
EAEAEKMRVSQQEFLSVDESVYTPDSDVAAPQINRNLIQKAGYLNLRNKTGLVTTTWERL
YFFTQGGNLMCQPRGAVAGGLIQDLDNCSVMAVDCEDRRYCFQITTPNGKSGIILQAESR
KENEEWICAINNISRQIYLTDNPEAVAIKLNQTALQAVTPITSFGKKQESSCPSVNKVTE
RKQMWSQCSHAGHWVPEKEWEKSVTVNPVAFSWVNVCLRFVNSGYSPRRTNPFGETEDES
FPEAEDSLLQQMFIVRFLGSMAVKTDSTTEVIYEAMRQVLAARAIHNIFRMTESHLMVTS
QSLRLIDPQTQVSRANFELTSVTQFAAHQENKRLVGFVIRIPESTGEESLSTYIFESNSE
GEKICYAINLGKEIIAVQKDPEALAQLMLSIPLTNDGKYVLLNSQPDDNDGNPSEHRGAE
SEA
Download sequence
Identical sequences ENSPANP00000010536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]