SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010554 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010554
Domain Number 1 Region: 611-836
Classification Level Classification E-value
Superfamily vWA-like 7.6e-63
Family Integrin A (or I) domain 0.00031
Further Details:      
 
Domain Number 2 Region: 46-238
Classification Level Classification E-value
Superfamily vWA-like 2.23e-56
Family Integrin A (or I) domain 0.00022
Further Details:      
 
Domain Number 3 Region: 323-442
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.42e-19
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 240-365
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.02e-18
Family Growth factor receptor domain 0.0065
Further Details:      
 
Domain Number 5 Region: 485-607
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.93e-16
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 447-495
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000312
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000010554
Domain Number - Region: 912-938
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.0432
Family Chicken cartilage matrix protein 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010554   Gene: ENSPANG00000024751   Transcript: ENSPANT00000023867
Sequence length 944
Comment pep:known_by_projection chromosome:PapAnu2.0:8:93184572:93354872:1 gene:ENSPANG00000024751 transcript:ENSPANT00000023867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKMLAGCFLLFLGQIVLLPAEARERSRGRSISRGRHARTHPQTALLESSCENKRADLVF
IIDSSRSVNTHDYAKVKEFLMDILQFLDIGPDVTRVGLLQYGSTVKNEFSLKTFKRKSEV
ERAVKRMRHLSTGTMTGLAIQYALNIAFSEAEGARPLRENVPRVIMIVTDGRPQDSVAEV
AAKARDTGILIFAIGVGQVDFNTLKAIGSEPHEDHVFLVANFSQIETLTSVFQRKLCTAH
MCSTLEHNCAHFCINIPGSYVCRCKQGYILNSDQTTCRIQDLCAMEDHNCGQLCVNVPGS
FVCQCYSGYALAEDGKSCVAVDYCASENHGCEHECVNADGSYLCQCHEGFALNPDKKTCT
KIDYCASSNHGCQHECVNTDDSYSCRCLKGFTLNPDKKTCRRINYCALNKPGCEHECVNT
EESYYCRCRRGYTLDPNGKTCSRVDHCAQQDHGCEQLCLNTEESFVCQCSEGFLINEDLK
TCSRLDYCLLSDHGCEYSCVSVDRSFACQCPEGHVLRSDGKTCAKLDSCALGDHGCEHSC
VSSEDSYVCQCFEGYILREDGKTCRRKDVCQAVDHGCEHICVNSDDSYTCKCLEGFRLAE
DGKRCQRKDVCKSTHHGCEHICVNNGISYSCKCSEGFVLAEDGRRCKKCTEGPIDLVFVI
DGSKSLGEENFEVVKQFVIGIIDSLTISPKAARVGLLQYSTQVRTEFTLRNFNSAKDMKK
AVAHMKYMGKGSMTGLALKHMFERSFTQGEGARPLSTRVPRAAIVFTDGRAQDDVSEWAS
KAKANGITMYAVGVGKAIEEELQEIASEPTDKHLFYAEDFSTMDEISEKLKKGICEALED
SDGRQDSPAGELPKRVQQPTESEPVTINIRDLLSCSNFAVQHRYLFEEDNLLRSTQKLSH
STKPSGSPLEEKHDQCKCENLIMFQNLANEEVRKLTQRYILFLY
Download sequence
Identical sequences A0A096NCK7
ENSPANP00000010554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]