SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010585 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010585
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000822
Family Phosphotyrosine-binding domain (PTB) 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010585   Gene: ENSPANG00000008996   Transcript: ENSPANT00000011131
Sequence length 191
Comment pep:known_by_projection chromosome:PapAnu2.0:17:12944744:12945316:1 gene:ENSPANG00000008996 transcript:ENSPANT00000011131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIYYDDQTRQNIEDKVHMPVDCINIRTGQECRDIQPPDGKSKDCMLQIVCRDGKTISLCA
ESTDDCLAWKFTLQDSRTNTAYVGSAVMTDETSVVSSPPPYTAYAAPAPEQAYGYGPYSG
AYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRERYRDNDSDLALGMLAGAAT
GMALGSLFWVF
Download sequence
Identical sequences ENSPANP00000010585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]