SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010625 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010625
Domain Number 1 Region: 96-282
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.36e-75
Family F-box associated region, FBA 0.0000000155
Further Details:      
 
Domain Number 2 Region: 31-126
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000628
Family F-box domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010625   Gene: ENSPANG00000018131   Transcript: ENSPANT00000019302
Sequence length 282
Comment pep:known_by_projection chromosome:PapAnu2.0:1:14490139:14499707:-1 gene:ENSPANG00000018131 transcript:ENSPANT00000019302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGDGDPESVGQPEEASPEEQPDEASAVAAAYLDELPEPLLLRVLAALPAAELVQACRLV
CLRWKELVDGAPLWLLKCQQEGLVPEGGAEEERDHWQQFYFLSKRRRNLLRNPCGEEDLE
GWCDVEHGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEWCRKAQIIDLQAEGYWEELL
DTTQPAIVVKDWYSGRSDAGCLYELTVKLLSEHEDVLAEFSSGQVAVPQDSDGGGWMEIS
HTFTDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP
Download sequence
Identical sequences ENSPANP00000010625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]