SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010651 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010651
Domain Number 1 Region: 226-489
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.65e-39
Family PhyH-like 0.065
Further Details:      
 
Domain Number 2 Region: 1113-1169
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.05e-20
Family Tudor domain 0.00038
Further Details:      
 
Domain Number 3 Region: 1170-1225
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000000473
Family Tudor domain 0.00028
Further Details:      
 
Domain Number 4 Region: 948-986
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000106
Family PHD domain 0.025
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000010651
Domain Number - Region: 1038-1080
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00142
Family PHD domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010651   Gene: ENSPANG00000011049   Transcript: ENSPANT00000025574
Sequence length 1290
Comment pep:known_by_projection chromosome:PapAnu2.0:19:4735280:4916433:1 gene:ENSPANG00000011049 transcript:ENSPANT00000025574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEVPSWWATWQVLVVDHLAWRLSCDPRSVQGWWAATPVLYRAGGLRPPFCTGLVGCDPR
SVQGWWAATPVLYRAGGLVDGPRDSRQLCWQEMSRPGWARCSPGPRFLPGLSSAGSSSQP
TVTHRPAPRGGAASPSACDPRPRPPTPSTTRRCASRTAAAMGSEDHGAQNPSCKIMTFRP
TMEEFKDFNKYVAYIESQGAHRAGLAKIIPPKEWKPRQTYDDIDDVVIPAPIQQVVTGQS
GLFTQYNIQKKAMTVGEYRRLANSEKYCTPRHQDFDDLERKYWKNLTFVSPIYGADISGS
LYDDDVAQWNIGSLRTILDMVERECGTIIEGVNTPYLYFGMWKTTFAWHTEDMDLYSINY
LHFGEPKSWYAIPPEHGKRLERLAIGFFPGSSQGCDAFLRHKMTLISPIILKKYGIPFSR
ITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATLRWIDYGKVATQCTCRKDMVKISMDV
FVRILQPERYELWKQGKDLTVLDHTRPTALTSPELSSWSASRASLKAKLLRRQISLKENR
HWKKTEEERKPSLERKKEQTKRPGLSSHRKRSQPKKPKPEDPKSPGEGTAGATLLEEAGG
SVKEEAGPEADPEEEEEEPQPLPHGREAEGAEEDGRGKLRPTKAKNERKKKSFGPLPPQL
PTPPAHFPSEEALWLPSSMEPTVLGPGPSATEESPLPAPLNVVPPEVPSEELEAKPRPII
PMLYVVPRPGKAAFNQEHMSCQQAFEHFAQKGPTWKEPASAMELMGPEDGGASSGAGRVE
TKVRAGEGQAPSTFSKLKMEIKKSRRHPLGRPPTRSPLSVVKQEASSDEEASPFSGEEDV
SDPEALRPLLSLQWKNRAASFQAERKFNAAAARTEPYCAICTLFYPYCQALQTEKEAPTA
SLGEGSLATLPSKSGQKTRPLIPEMCFTSGGENTEPLPANSYIGDDGTSPLIACGKCCLQ
VHASCYGIRPELVNEGWTCSRCAAHAWTAECCLCNLRGGALQMTTDRRWIHVICAIAVPE
ARFLNVIERHPVDISAIPEQRWKLKCVYCRKRMKKVSGACIQCSYEHCSTSFHVTCAHAA
GVLMEPDDWPYVVSITCLKHKSGGHAVQLLRAVSLGQVVITKNRNGLYYRCRVIGAATQT
CYEVNFDDGSYSDNLYPESITSRDCVRLGPPSEGELVELRWTDGNLYKAKFISSVTSHIY
QVEFEDGSQLTVKRGDIFTLEEELPKRVRSRLSLSTGAPQEPAFSGEEAKAAKRPRVGTP
LATEDSGRSQDYVAFVESLLQAQGRPGGPF
Download sequence
Identical sequences ENSPANP00000010651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]