SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010747 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010747
Domain Number 1 Region: 398-661
Classification Level Classification E-value
Superfamily YWTD domain 5.49e-50
Family YWTD domain 0.000000000146
Further Details:      
 
Domain Number 2 Region: 282-394,666-711
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.39e-16
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 142-183
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000301
Family LDL receptor-like module 0.00011
Further Details:      
 
Domain Number 4 Region: 104-144
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000759
Family LDL receptor-like module 0.00012
Further Details:      
 
Domain Number 5 Region: 196-232
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000103
Family LDL receptor-like module 0.00016
Further Details:      
 
Domain Number 6 Region: 26-64
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000117
Family LDL receptor-like module 0.00012
Further Details:      
 
Domain Number 7 Region: 230-271
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.00014
Further Details:      
 
Domain Number 8 Region: 62-104
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010747   Gene: ENSPANG00000018406   Transcript: ENSPANT00000017826
Sequence length 861
Comment pep:known_by_projection chromosome:PapAnu2.0:19:10041908:10084407:1 gene:ENSPANG00000018406 transcript:ENSPANT00000017826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPWGWKLRWTVAFLLAAAEAAVGDRCERNEFQCEDGKCISYKWVCDGTAECQDGSDESQ
ETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGEVDCENGSDERDCPPKTCSQDEFRCHDGK
CIYRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEW
PQRCQGLEVPKRDSSPCSAFEFHCRSGECIHSAWRCDGGPDCKDKSDEENCPVATCRPDE
FQCSDGTCIHGSRQCDREYDCKDMSDEVGCINVTLCEGPNKFKCHSGECISLDKVCNMAR
DCRDWSDEPIKECGTNECLDNNGGCSHICNDLKIGYECLCPDGFQLVAQRRCEDIDECQD
PDTCSQLCVNLEGSYKCQCEEGFQLDPHTKACKAVGSIAYLIFTNRHEVRKMTLDRSEYT
SLIPNLRNVVALDTEVASNRIYWSDLSQRMIYSTQLDRAHSVSSYDTVISRDLQAPDGLA
VDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPA
KIKKGGLNGVDIYSLVTENIQWPNGITLDFPSGRLYWVDSKLHSISSINVNGGNRKTVLE
DEKRLAHPFSLAIFEDKVFWTDIINEAIFSANRLTGSDINLLAENLLSPEDMVLFHNLTQ
PRGVNWCERTTLSNGGCHYLCLPAPQINPQSPKFTCTCPDGMLLAKDMRSCLTEAEAAVA
TQETSTVRLMVSSKAVATQHTTTRPVPNTSQLPGATPGLTTAETVTMSHQALGDVAGRGN
EEKPKSVGALSIVLPTGDLVPGQLGLFTFSPGQGTAPLSVPYHPDSLSRLRADSDKIRQC
RNQDGYSYPSRQMVSLEDDVA
Download sequence
Identical sequences ENSPANP00000010747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]