SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010773 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010773
Domain Number 1 Region: 1784-2029
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.39e-54
Family Ankyrin repeat 0.0000000622
Further Details:      
 
Domain Number 2 Region: 573-702
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000235
Family Growth factor receptor domain 0.0082
Further Details:      
 
Domain Number 3 Region: 391-514
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000033
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 4 Region: 270-438
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000141
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 5 Region: 510-552
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000719
Family EGF-type module 0.006
Further Details:      
 
Domain Number 6 Region: 1057-1167
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000129
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 7 Region: 813-934
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000455
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 8 Region: 161-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000116
Family EGF-type module 0.0021
Further Details:      
 
Domain Number 9 Region: 1177-1218
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000371
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 923-965
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000102
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 11 Region: 965-1004
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000102
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 12 Region: 201-243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000177
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 13 Region: 239-282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000234
Family EGF-type module 0.015
Further Details:      
 
Domain Number 14 Region: 1004-1044
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000657
Family EGF-type module 0.017
Further Details:      
 
Domain Number 15 Region: 1472-1505
Classification Level Classification E-value
Superfamily Notch domain 0.0000000798
Family Notch domain 0.0035
Further Details:      
 
Domain Number 16 Region: 738-774
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000339
Family EGF-type module 0.012
Further Details:      
 
Domain Number 17 Region: 45-81
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000589
Family EGF-type module 0.027
Further Details:      
 
Domain Number 18 Region: 124-166
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000062
Family EGF-type module 0.013
Further Details:      
 
Domain Number 19 Region: 776-818
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000009
Family EGF-type module 0.012
Further Details:      
 
Domain Number 20 Region: 1391-1423
Classification Level Classification E-value
Superfamily Notch domain 0.000000994
Family Notch domain 0.0014
Further Details:      
 
Domain Number 21 Region: 695-735
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000104
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 22 Region: 1431-1463
Classification Level Classification E-value
Superfamily Notch domain 0.00000209
Family Notch domain 0.0049
Further Details:      
 
Domain Number 23 Region: 83-121
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000237
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000010773
Domain Number - Region: 1208-1248
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000292
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 1251-1282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00158
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 1361-1380
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00911
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010773   Gene: ENSPANG00000016653   Transcript: ENSPANT00000008331
Sequence length 2309
Comment pep:known_by_projection chromosome:PapAnu2.0:19:13891185:13933737:-1 gene:ENSPANG00000016653 transcript:ENSPANT00000008331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGPRVPDRVRRSWRRGGWPGTRPEPSVRALPLLLLLAGPGAAAPPCLDGSPCANGGRCTQ
LPSREAACLCPPGWVGEWCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDC
SLPDPCLSSPCAHSARCSVGPDGRFLCSCPPGYQGRSCRSDVDECRVGEPCRHGGTCLNT
PGSFRCQCPAGYTGPLCENPAVPCAPSPCRNGGTCRQSGDLTYDCACLPGFEGQNCEVNV
DDCPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGG
HSCVCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVS
NPCHEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLC
QCGRGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDIDECQSSP
CVNGGVCKDRVNGFSCTCPSGFSGSTCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGF
EGMLCERNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGTRCESQVDECRSQPCRHGGKC
LDLVDKYLCRCPSGTTGVNCEVNIDDCASNPCSFGVCRDGINRYDCVCQPGFTGPLCNVE
INECASSPCGEGGSCVDGENGFRCLCPPGSLPPLCLPPSHPCAHESCSHGICYDAPGGFR
CVCEPGWSGPRCSQSLARDACESQPCRAGGTCSSDGMGFHCTCPPGVQGRQCELLSPCTP
NPCEHGGRCESTPGQLPVCSCPQGWQGPRCQQDVDECAGPAPCGPHGICTNLAGSFSCTC
HGGYTGPSCDQDINDCDPNPCLNGGSCQDGVGSFSCSCLHGFAGPRCARDVDECLSNPCG
PGTCTDHVASFTCTCPPGYGGFHCEQDLPDCSPSSCFNGGTCVDGVNSFSCLCSPGYTGA
HCQHEADPCLSRPCLHGGVCSAAHPGFRCTCPQSFTGPQCQTLVDWCSRQPCQNGGRCVQ
TGAYCLCPPGWSGRLCDIRSLPCREAAAQIGVRLEQLCQAGGQCVDEDSSHYCVCPEGRT
GSHCEQEVDPCLAQPCQHGGRCRGYMGGYMCECLPGYNGENCEDDVDECASQPCQHGGSC
IDLVARYLCSCPPGTLGVLCEINEDDCGPGPPLDSGPRCLHNGTCVDLVGGFRCTCPPGY
TGLRCEADINECRSGACHAAHTRDCLQDPGGGFRCLCHAGFSGPRCQTVLSPCESQPCQH
GGQCRPSPGPGGGLTFTCHCAQVGVGGGLWRRGRGVGSGVPPPTFPGGLKGKGGEGAWPP
GVAGRVCQVGSPLWKGERLASPNLTPNRSGGPRCERMARFCREFRCACAQGWTGPRCEAP
AVAPEVSEEPRCPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWR
LFNNSRCDPACSSPACLYDNFDCHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGW
DGLDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMV
FPYHRPNPGSEPRARRELAPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALS
AVERLDFPYPLRDVRGEPLEPPEPSVPLLPLLVAGAVLLLVILVLGVMVARRKREHSTLW
FPEGFSLHKDVATGHKGRREPVGQDALGMKNMAKGESLMGEVATDWMDTECPEAKRLKVE
ELGMGAEEAVDCRQWTQHHLVAADIRVAPAMALTPPQGDADADGMDVNVRGPDGFTPLML
ASFCGGTLEPMPTEEDEADDTSASIISDLICQGAQLGARTDRTGETALHLAARYARADAA
KRLLDAGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARMADGSTALILAAR
LAVEGMVEELIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDSKEETP
LFLAAREGSYEAAKLLLDHFANREITDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPPG
THGLGPLLCPPGAFLPGLKATQSGSKKSRKKLTLACPGPLADSSVTLSPVDSLDSPRPFG
GPPASPGGFPLEGPYAAATATAVSLAQLGGPGRAGLGRQPPGGCVLSLGLLNPVAVPLDW
ARLPPPAPPGPSFLLPLAPGPQLLNPGTPVSPQERPPPYLAVPGHGEEYPAAGAHSSPPK
ARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSESTPSPATATGAMATATGALPAQPL
PLSVPSSLAQAQTQLGPQPEVTPKRQVLA
Download sequence
Identical sequences ENSPANP00000010773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]