SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010785 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010785
Domain Number 1 Region: 170-228
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000311
Family BSTI 0.037
Further Details:      
 
Domain Number 2 Region: 555-614
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000054
Family BSTI 0.055
Further Details:      
 
Domain Number 3 Region: 944-1003
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000556
Family ATI-like 0.017
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000010785
Domain Number - Region: 1656-1697
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000558
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010785   Gene: ENSPANG00000000279   Transcript: ENSPANT00000005851
Sequence length 1726
Comment pep:known_by_projection chromosome:PapAnu2.0:14:110447318:110526063:1 gene:ENSPANG00000000279 transcript:ENSPANT00000005851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTAVETDFGLLVTFDGQHYASISIPGSYINSTCGLCGNYNKNPLDDFLRPDGRPAMSVL
DLGESWRVYHADWKCDSGCVDNCTQCDAATEALYFGSDYCGFLNKTDGPLWECGTVVDPT
AFVHSCVYDLCSVRDNGTLLCQAIQAYALVCQALGIPIGDWRTQTGCVSTVQCPSFSHYS
VCTSSCPDTCSDLTASQNCATPCTEGCECNQGFVLSTSQCVPLHKCGCDFDGHYYTMGEF
FWATANCTVQCLCEEGGDIYCFNKTCSSGEVCAVEDGYQGCFPKRETVCLLSQNEVLHTF
DGAAYAFPSEFSYTLLKTCPERPEYLEIDINKKKPDAGPAWLRGLRILVANQEVKIGGIG
ASEVKLNGQEVELPFFHPSGKLEIYRNKNSTTVESRGVVTVQYSDVGLLYIRLSTTYFNC
TGGLCGFFNANVSDEFCLPNGKCTDNLAVFLESWTTFEEICNGECGDLLKACNNDSELLK
FYRSRSRCGIINDPSNSSFLECHGVVNVTAYYRTCLFRLCQSGGNESELCDSVARYASAC
KNADVEVGPWRTYDFCPLECPENSHFEECITCTETCETLALGPICVDSCSEGCQCDEGYA
LLGSQCVTRSECGCNFEGHQLVTNETFWVDLDCQIFCYCNGTDNSVHCETVPCKDDEYCM
EEGGLYYCQARTDASCIVSGYGHYLTFDGFSFDFQTSCPLILCTTGSRPSSDSFPKFVVT
AKNEDRDPSLALWVKQVDVTVFGYSIVIHRAYKHTVLVNSERLYLPLKLGQGKINIFSFG
FHVVVETDFGLKVVYDWKTFLSITVPRSMQNSTYGLCGRYNGNPDDDLEMPIGLLASSVN
EFGQSWVKRDTFCQVGCGDRCPSCAKVEGFSKVQQLCSLIPNQNAGFSKCHSKVNPTFFY
KNCLFDSCIDGGAVQTACSWLQNYASTCQTQGITVTGWRNYTSCTVTCPPNSHYESCVSV
CQPRCAAIRLKSDCSHYCVEGCQCDAGYVLNGKSCILPHSCGCYSDGKYYEPKQLFWNSD
CTRRCRCFRRNLIQCDPRQCKSDEECALRNGVRGCFSTKTSYCLAAGGGVFRTFDGAFLR
FPANCAFVLSTICQKLPDISFQLIINFDKWSAPNLTIISPVYFYINEEQILISDRNTVKV
NGTQVNVPFITGLATKIYSSEGFLVIDTSPDIQIYYNGFNVIKISISERLQNKVCGLCGN
FNGDLTDDYVTLRGKPVVSSVVLAQSWKTNGMQKSCNELQFSQYAAMCDNVHIQKMQGDG
YCLKLTDMKGFFQPCYGLLDPLPFYESCYLDGCYNHKKFQLCGSLAAYGEACRSFGILST
EWIEKENCSGVVEDPCVGADCPNRTCELGNGRELCGCIEPPPYGNNSHDIIDAEVTCKAS
QMEVSISKCKLFQLGFEREGVRINDRQCTGIEGEDFISFQINNTKGNCGNIVQSNGTHIM
YKNTIWIESANNTGNIITRDRTINVEFSCAYELDIKISLDSVVKPMLSVINLTVPTQEGS
FTTKMALYKNASYKHPYRQGEVVLTTRDVLYVGVFVVGADSTHLILTLNKCYATPSRDSN
DKLRYFIIEEGCQNIKDNTIGIEENAVSLTCRFHVTVFKFIGDYDEVHLHCAVSLCDSEK
YSCKITCPQNSRSATDYTKEPKEQIISVGPIRRKRLDWCEDNGGCEQICTSRVDGPLCSC
VTGTLQEDGKSCRASNSSVELQVWTLLLVMIQISLWHFVYKSGTIS
Download sequence
Identical sequences ENSPANP00000010785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]