SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010801 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010801
Domain Number 1 Region: 57-393
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.37e-80
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000019
Further Details:      
 
Domain Number 2 Region: 407-500
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.93e-20
Family Anticodon-binding domain of Class II aaRS 0.0043
Further Details:      
 
Domain Number 3 Region: 5-57
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.000000000392
Family a tRNA synthase domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010801   Gene: ENSPANG00000011928   Transcript: ENSPANT00000013741
Sequence length 509
Comment pep:known_by_projection chromosome:PapAnu2.0:6:134192842:134209946:-1 gene:ENSPANG00000011928 transcript:ENSPANT00000013741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERAALEELVKLQGERVRGLKQQKASAELIEEEVGKLLKLKAQLGPDESKQKFVLKTPK
GTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLTGKYGEDSKLIYDLKDQ
GGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAG
NFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDK
LDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLG
DLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQAGEEPLGVGSVAAG
GRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEALEEKVRTTETQVLVASAQKKL
LEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRS
VTSREEVNVRREDLVEEIKRRTGQPLCIC
Download sequence
Identical sequences A0A096ND58
ENSPANP00000010801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]