SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010814 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010814
Domain Number 1 Region: 34-175
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000385
Family C-type lectin domain 0.004
Further Details:      
 
Domain Number 2 Region: 261-292
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000248
Family EGF-type module 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010814   Gene: ENSPANG00000007425   Transcript: ENSPANT00000014126
Sequence length 491
Comment pep:known_by_projection chromosome:PapAnu2.0:7:94679976:94681448:-1 gene:ENSPANG00000007425 transcript:ENSPANT00000014126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPAFALCLLWQALWLGPGGGEHPTADRAGCSASGACYSLHHATMKRQAAEEACNLRGGA
LSTVRGGAELRAVLALLRAGPGPGGGSKDLLFWVALERGRSHCTLENEPLRGFSWLSSDA
GGFESDTLQWVEEPQRSCTARRCAVLQATGGVEPAGWKEMRCHLRANGYLCKYQFEVLCP
APRPGAASNLSYRAPFQLYSAALDFSPPGTKVSALCGGQLPISVTCIADEIGARWDKLSS
GDVLCPCPGRYLRAGKCAELPNCLDDLGGFACECATGFELGKDGRSCVTSGEGQPTLGGT
RVSTRLPPATATSPVQQRTWSIRVDEKPGEIPLVPEQHNSVTSIPEIPRWGSQSTMSTLQ
MSLQAESKATITPSGSVISKFNSTISSATPQVFDTSSAVVFIFVSTAVVVLVILTMTVLG
LVKLCFHKSPSSQPRKESVGPPGLEGDPEPAALGSSSAHCTNNGVKVGDCGLRDRAEGAL
LAESSLGSSDA
Download sequence
Identical sequences ENSPANP00000010814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]