SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010846 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010846
Domain Number 1 Region: 73-167
Classification Level Classification E-value
Superfamily EF-hand 8.99e-19
Family Calmodulin-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010846   Gene: ENSPANG00000021488   Transcript: ENSPANT00000006344
Sequence length 222
Comment pep:known_by_projection chromosome:PapAnu2.0:1:17845678:17887377:1 gene:ENSPANG00000021488 transcript:ENSPANT00000006344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATDELATKLSRRLQMEGEGGGETPEQPGLNGAAAAAAGAPDEAAEALGSADCELSAKLL
RRADLNQGIGEPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLM
MEKLGAPQTHLGLKNMIKEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLCVLARLSEI
DVSSEGVKGAKSFFEAKVQAINVSSRFEEEIKAEQEEWKKQA
Download sequence
Identical sequences A0A096NDA2
ENSPANP00000010846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]