SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010889 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010889
Domain Number 1 Region: 7-55
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000533
Family S100 proteins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010889   Gene: ENSPANG00000019271   Transcript: ENSPANT00000001108
Sequence length 62
Comment pep:novel chromosome:PapAnu2.0:1:127221968:127224817:-1 gene:ENSPANG00000019271 transcript:ENSPANT00000001108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSLGRKEPYYITELFQAADKNKDNQICFDEFLYILGKLVKDYHLQYHRQLCAHHCAQHS
LY
Download sequence
Identical sequences ENSPANP00000010889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]