SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010898 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010898
Domain Number 1 Region: 377-451
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000115
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.022
Further Details:      
 
Domain Number 2 Region: 91-152
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000253
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010898   Gene: ENSPANG00000010033   Transcript: ENSPANT00000010198
Sequence length 3815
Comment pep:known_by_projection chromosome:PapAnu2.0:2:85643154:85683542:-1 gene:ENSPANG00000010033 transcript:ENSPANT00000010198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STSRRLDPKEPLGSQRAASPTPKQASATTPGQESPQETRAQGPAGQEADGPRRTLQVDSR
TQRSGRSPSVSPDRGSTPTSPYSVPQIAPLPSSTLCPICKTSDLTSTPSQPNFNTCTQCH
NKVCNQCGFNPNPHLTQVKEWLCLNCQMQRALGMDMTTAPRSKSQQQLHSPALSPAHSPA
KQPLGKPEQERSRGPGGLQPGSRQGEMARATSVPEPAQAAAPPEVGRVSPQPPQPTKPST
AEPRPPAGEAPAKSATAVPTGLGATEQTQEGLTGKLFGLGASLLTQASTLMSVQPEADTQ
GQPAPSKGSPKIVFSDASKEAGPKPLGLGPGPGPAPGAKTEPGARTGPGSGPGALPKTGG
TTSPKHGRAEHQAASKAAAKPKTMPKERATCPLCQAELNVGSKSPANYNTCTTCRLQVCN
LCGFNPTPHLVEKTEWLCLNCQTKRLLEGSLGEPTPVLPPTSQQPPVGAPRRASGASPLK
QKGSQGLGQPSGPLPAKASPLSTKASPLPTKASPQAKPLRASEPSKTPSSAQEKKTGVPT
KAEPMPKPPPETTPTPGTPKVKSGVRRAEPATPVVKAVPEAPKGGEAEDLVGKPYSQDMS
RSPQSLSDTGYSSDGISSSQSEITGVVQQEVEQLDSAGVTGPHPPSPSEIHKVGSSMRPL
LQAQGLAPSGERSKPLSSSTGEEQKQRPHSLSITPEAFDSDEELEDILEEDEDSVEWRRR
REKQDTAESSDDFGSQLRHDYVEDSSEGGLSPLPPQPPARAAELTDEEFMRRQILEMSAE
EDNLEEDDTATSGRGLAKHGTQKGGPRPRPEPSQEPAALPKRRLPHNATTGYEELLPEGG
LAEATDGSGALQGGLRRFKTIELNSTGSYSHELDLGQGPDPSLDREPELEMESLTGSPED
RSRGEHSSTLPASTPSYTSGTSPTSLSSLEEDSDSSPSRRQRLEEAKQQRKARHRSHGPL
LPTIEDSSEEEELREEEELLREQEKMREVEQQRIRSTARKTRRDKEELRAQRRRERSKTP
PSNLSPIEDASPTEELRQAAEMEELHRSSCSEYSPSPSLDSEAEALDGGPSRLYKSGSEY
NLPTFMSLYSPTETPSGSSTTPSSGRPLKSAEEAYEEMMRKAELLQRQQGQAAGARGPHG
GPSQPTGPRGLGSFEYQDTADRDYGRAAQPAAEGTPASLGAAVYEEILQTSQSIVRMRQA
SSRDLAFAEDKKKEKQFLNAESAYMDPMKQNGGPLTPGTSPTQLTAPVSFSTPTSSDSSG
GRVIPDVRVTQHFAKETQDPLKLHSSPASPSLTSKEVGMPFSQGPGTPATTAVAPCPAGL
PRGYMTPASPAGSERSPSPSSTAHSYGHSPTTANYGSQTEDLPQAPTGLAAAGQAAREKP
LSASDGEGGTPQPSRAYSYIASSSPPLSPSSPSESPTFSPGKLGPRATAEFSTQTPSPAP
ASDMPRSPGAPTPSPMVAQGTQTPHRPSTPRLVWQESSQEAPFMVITLASDASSQTRMVH
ASASTSPLCSPTEIQPTTHGYSQTTPPSVSQLPPEPPGPPGFPRAPSAGADGPLALYGWG
ALPAENISLCRISSVPGTSRVEPGPRPPGTAVVDLRTAVKPTPIILTDQGMDLTSLAVEA
RKYGLALDPIPGRQSTAVQPLVINLNAQEQTHTFLATATTVSITMASSVLMAQQKQPVVY
GDPYQSRLDFGQGGGSPVCLAQVKQVEQAVQTAPYRSGPRGRPREAKFARYNLPNQVAPL
ARRDVLITQMGTAQSIGLKPGPVPELGAEPHRATPAELRSHALPGARKPHTVVVQMGEGT
AGTVTTLLPEEPAGALDLTGMRPESQLACCDMVYKLPFGSSCTGTFHPAPSVPEKSMADA
APPGQSSGPFYGPRDPEPPEPPTYQAQGAVGPGPHEEQRPYPQGLPGRLYSSMSDTNLAV
AGLNYHAQRIGQLFQGPGRESAMDLSSLKHSYSLGFADGRYLGQGLQYGSVTDLRHPTDL
LAHPLPMRRYSSVSNIYSDHRYGPRGEAVGFQEASLAQYSATTAREISRMCAALNSMDQY
GGRHGIGGGGPDLVQYQPQHGPGLSAPQSLAPLRPGLLGNPTFPEGHPSPGNFAQYGPAA
GQGTAVRQLLPSTATVRAADGMIYSTINTPIAATLPITTQPASVLRPMVRGGMYRPYASG
GITAVPLTSLTRVPMIAPRVPLGPTGLYRYPAPSRFPIASSVPPAEGPVYLGKPAAAKAS
GTGGPPRPEIPVGAVREEPLPTTTPAAIKEAAGVPAPAPLAGQKPPVDAAPGGGSGALSR
SGLEKEEASQEERQRKQQEQLLQLERERVELEKLRQLRLQEELERERVELQRHREEEQLL
VQRELQELQTIKHHVLQQQQEERQAQFALQRGQKAPFPAACEAPGRGPPLAAAELAQNGQ
YWPPLTHAAFIAMAGPEGPGQPREPVLHRGLPSSASDMSLQTEEQWEASRGGIKKRHSMP
RLRDACEPESVAEPCMVRRIADSSVQTDDEDGEGRYLLSRRRRARRSADCSVQTDDEDSA
EWEQPVRRRRSRLPRHSDSGSDSKHDATASSSSAAATVRAMSSVGIQTISDCSVQTEPDQ
LPRVSPAIHITAATDPKVEIVRYISAPEKTGRGESLACQTEPDGQAQGVAGPQLVGPTAI
SPYLPGIQIVTPGPLGRFEKKKPDPLEIGYQAHLPPESLSQLVSRQPPKSPQVLYSPVSP
LSPHRLLDTSFASSERLNKAHVSPQKHFTADSAFRQQTLPRPMKTLQRSLSDPKPLSPTA
EDSAKERFSLYQHQGGLGSQVSALPPNSLVRKVKRTLPSPPPEEAHLPLAGQASPQLYAA
SLLQRGLTGPTAVPATKASLLRELDRDLRLVEHESTKLRKKQAELDEEEKEIDAKLKYLE
LGITQRKESLAKDRGGRDYPPLRGLGEHRDYLSDSELNQLRLQGCTTPAGQYVDFPATAT
APAAPSGPTAFQQPRFQPPTPQYSAGSGGPTQNGFPAHQAPTYPGPNTYPAPAFPPGTSY
PAEPGLPNQQAFRPTGHYAGQTPMPTTQSTLFPVPADSRAPLQKPHQTSLADLEQKVPTN
YEVIASPVVAMSSAPSETSYSGSAVSSSYEQGKVPEVPRAGERGSASQSPAPTYPSDSHY
TSLEQNVPRNYVMIDDISELTKDSTSTAPDSQRLEPLGPGSSGRPGKELGEPGVLEGPTL
PCCYARGEEESEEDSYDPRGKGGHLRSMESNGRPASSHYYGDGDYRHGARAEKYGPGPMG
PKHPSKSLAPAAISSKRSKHRKQGMEQKISKFSPIEEAKDVESDLASYPPPAVSSSLVSR
GRKFQDEITYGLKKNVYEQQRYYGMSTRDTVEEDDRIYGGSSRSRAPSAYSGEKLSSHDF
SGRGKGYEREREAVERLQKAGPKPSSLSMAHSRARPPMRSQASEEESPVSPLGRPRPAGG
PLPPSGDTCPQFCSSHSMPDVQEHVKDGPRAHAYKREEGYILDDSHCVVSDSEAYHLGQE
ETDWFDKPRDARSDRFRHHGGHAVSSSSQKRGPARHSYHDYDEPPEEGLWPHDEGGPGRH
ASAKEHRHHGDHGRHSGRHTGEEPGRRAAKPHARDLGRHEARPHSQPSSAPAMPKKGQPG
YPSSAEYSQPSRAPSAYHHASDSKKGSRQAHSGPAALQSKAEPQAQPQLQGRQAAPGPQQ
SQSPSSRQMPSEGLGLQPPQQAPTQARLQQQSQPTARGSAPAASQPAGKPQPGPTTATGP
QPAGPPRAEQTNGSKGTAKAPQQGRAPQAQPTPGPGPAGVKAGARPGGTPGAPASQPGAD
GESVFSKILPGGAAEQAGKLTEAVSAFGKKFSSFW
Download sequence
Identical sequences ENSPANP00000010898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]