SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010920 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010920
Domain Number 1 Region: 177-283
Classification Level Classification E-value
Superfamily TPR-like 0.00000000178
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010920   Gene: ENSPANG00000009809   Transcript: ENSPANT00000013235
Sequence length 533
Comment pep:known_by_projection chromosome:PapAnu2.0:2:112590160:112800913:1 gene:ENSPANG00000009809 transcript:ENSPANT00000013235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAGSSRSLENAVNRIYHDQLVPKINTSKKMSTLAHPPNILEMPQEIKKNCGGKQVEITL
ERIKMTKSIKEKQSNDLEKAAFKRKAEGEEKPTRKKEAKIIELDNQLITMPLPHIPLKNI
MDVEMKLVYIDEVGVRYEFVESFMSTGSQPTCRVAEIVDPLSVPNFSFLPQIDKWLQVAL
KDASSCYRQKKYALAAGQFRTALELCSKGAVLGEPFDASAEDIASVASFIETKLVTCYLR
MRKPDLALNHAHRSIVLNPAYFRNHLRQATVFRCLERYSEAARSAMIADYMFWLGGGREQ
SISKLIKLYWQAMIEEAITRAESFSVMYTPFATKIRADKIEKVKDVFTKTHPAYAEYIYT
DLQTLHMLPQTVDWSSFPPQQYLLTLGFKNKEDGKFLEKISSRKLPIFTEHKTPFGLTRE
DTVRQMETMGKRILPILDFIRSTQLNGSFPASSGVMEKLQYAGLLSQLQRVKEQSQVINQ
AMAELATIPYLRDISQQEAELVPQLQSLMADAMDTLEGRRNDNERVWNTIQKV
Download sequence
Identical sequences ENSPANP00000010920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]