SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010945 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010945
Domain Number 1 Region: 14-219
Classification Level Classification E-value
Superfamily PH domain-like 2.66e-40
Family Pleckstrin-homology domain (PH domain) 0.0000000286
Further Details:      
 
Domain Number 2 Region: 283-358
Classification Level Classification E-value
Superfamily SH3-domain 9.19e-16
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010945   Gene: ENSPANG00000006185   Transcript: ENSPANT00000027943
Sequence length 359
Comment pep:known_by_projection chromosome:PapAnu2.0:3:84064735:84266012:1 gene:ENSPANG00000006185 transcript:ENSPANT00000027943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNPSSTSSPYPLPEEIRNLLADVETFVADTLKGENLSKKAKEKRESLIKKIKDVKSVYL
QEFQDKGDAEDGEEYDDPFARPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKA
GYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKELKQKGHFKKKKAKVSLNNTLAPS
SKYDISFMAKRPSNSIQQFTAASPKDAEEWVQQLKFVLQDMESDIIPEDYDERGELYDDV
DHPLPISNPPTSSQPIDDEIYEELPEEEEDSAPVKVEEQRKMSQDSVHHTSGDKSTDYAN
FYQGLWDCTGAFSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPKAYIMEMYDI
Download sequence
Identical sequences ENSPANP00000010945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]