SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010952 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010952
Domain Number 1 Region: 1126-1345
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.7e-85
Family Fibrinogen C-terminal domain-like 0.000000856
Further Details:      
 
Domain Number 2 Region: 595-768
Classification Level Classification E-value
Superfamily Fibronectin type III 4.11e-24
Family Fibronectin type III 0.0000096
Further Details:      
 
Domain Number 3 Region: 955-1123
Classification Level Classification E-value
Superfamily Fibronectin type III 4.09e-22
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 4 Region: 778-937
Classification Level Classification E-value
Superfamily Fibronectin type III 5.85e-21
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 5 Region: 328-504
Classification Level Classification E-value
Superfamily Fibronectin type III 1.67e-20
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 6 Region: 502-592
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000201
Family Fibronectin type III 0.00000434
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000010952
Domain Number - Region: 300-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000188
Family EGF-type module 0.081
Further Details:      
 
Domain Number - Region: 208-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00147
Family Integrin beta EGF-like domains 0.038
Further Details:      
 
Domain Number - Region: 239-262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00147
Family Integrin beta EGF-like domains 0.072
Further Details:      
 
Domain Number - Region: 270-294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.009
Family Integrin beta EGF-like domains 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010952   Gene: ENSPANG00000010282   Transcript: ENSPANT00000012932
Sequence length 1358
Comment pep:known_by_projection chromosome:PapAnu2.0:1:197935837:198132695:-1 gene:ENSPANG00000010282 transcript:ENSPANT00000012932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGADGETVVLKNMLIGVNLILLGSMLKPSECQLEVTTERVQRQSVEEEGGIANYNTSSKE
QPVVFNHVYNINVPLDSLCSSGLEASAEQDVSAEDETVAEYTGQTSDHESQVTFTHRINL
PKKACPCASSAQMLQELLSRIEMLEREVSVLRDQCNANCCQESAATGQLDYIPHCSGHGN
FSFESCGCICNEGWFGKNCSEPYCPLGCSSRGVCVDGQCICDSEYSGDDCSELRCPTDCS
SRGLCVDGECVCEEPYTGEDCRELRCPGDCSGKGRCANGTCLCEEGYVGEDCGQRQCLNA
CSGRGQCEEGLCICEEGYQGPDCSAVAPPEDLRVAGISDRSIELEWDGPMAVTEYVISYQ
PTALGGLQLQQRVPGDWSGVTITELEPGLTYNISVYAVISNILSLPITAKVATHLSTPQG
LQFKTITETTVEVQWEPFSFSFDGWEISFIPKNNEGGVIAQVPSDVTSFNQTGLKPGEEY
IVNVVALKEQARSPPTSASVSTVIDGPTQILVRDVSDTVAFVEWIPPRAKVDFILLKYGL
VGGEGGRTTFRLQPPLSQYSVQALRPGSCYEVSVSAVRGTNESDSATTQFTTEIDAPKNL
RVGSRTATSLDLEWDNSEAEVQEYKVVYSTLAGEQYHEVLVPKGIGPTTRTTLTDLVPGT
EYGVGISAIMNSQQSVPATMNARTELDSPRDLMVTASSETSISLIWTKASGPIDHYRITF
TPSSGIASEVTVPKDRTSYTLTDLEPGAEYIISITAERGRQQSLESTVDAFTGFRPISHL
HFSHVTSSSVNITWSDPSPPADRLILNYSPRDEEEEMTEVSLDATKRHAVLMGLQPATEY
IVNLVAVHGTVTSEPIVGSITTGIDPPKDITISNVTKDSVMVSWSPPVASFDYYRVSYRP
TQVGRLDSSVVPNTVTEFTITRLYPATEYEISLNSVRGREESERICTLVHTAMDNPVDLI
ATNITPTEALLQWKAPVGEVENYVIVLTHFAVAGETILVDGVSEEFRLVDLLPSTHYTAT
MYATNGPLTSGTISTNFSTLLDPPANLTASEVTRQSALISWQPPRAEIENYVLTYKSTDG
SRKELIVDAEDTWIRLEGLLENTDYTVLLQAAQDTAWSSITSTAFTTGGRVFPHPQDCAQ
HLMNGDTLSGVYPIFLNGELSQKLQVYCDMTTDGGGWIVFQRRQNGQTDFFRKWADYRVG
FGNLEDEFWLGLDNIHRITSQGRYELRVDMRDGQEAAFASYDRFSVEDNRNLYKLRIGSY
NGTAGDSLSYHQGRPFSTEDRDNDVAVTNCAMSYKGAWWYKNCHRTNLNGKYGESRHSQG
INWYHWKGHEFSIPFVEMKMRPYSHRLMAGRKRQSLQF
Download sequence
Identical sequences A0A096NDK5
ENSPANP00000010952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]