SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010953 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010953
Domain Number 1 Region: 662-812
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-43
Family C-type lectin domain 0.00000565
Further Details:      
 
Domain Number 2 Region: 151-265
Classification Level Classification E-value
Superfamily C-type lectin-like 1.55e-42
Family Link domain 0.0051
Further Details:      
 
Domain Number 3 Region: 267-360
Classification Level Classification E-value
Superfamily C-type lectin-like 1.57e-30
Family Link domain 0.0067
Further Details:      
 
Domain Number 4 Region: 44-155
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000223
Family V set domains (antibody variable domain-like) 0.048
Further Details:      
 
Domain Number 5 Region: 812-871
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000195
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010953   Gene: ENSPANG00000024683   Transcript: ENSPANT00000028473
Sequence length 917
Comment pep:known_by_projection chromosome:PapAnu2.0:1:130532333:130550642:1 gene:ENSPANG00000024683 transcript:ENSPANT00000028473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQLLLPLLAALVLAQAPAALADVLEGDSAEDRAFRVRISGHAPLQGVLGGALTIPCHVH
YLRPPPSRRAVLGSPRVKWTFLSGGREAEVLVARGVRVKVNEAYRFRVALPAYPASLTDV
SLALSELRPNDSGIYRCEVQHGIDDSSDAVEVKVKGVVFLYREGSARYAFSFVGAQEACA
RIGAHIATPEQLYAAYLGGYEQCDAGWLSDQTVRYPIQTPREACYGDMDGFPGVRNYGVV
DPDDLYDVYCYAEDLNGELFLGDPPEKLTLEEARAYCQERGAEIATTGQLYAAWDGGLDR
CSPGWLADGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNVYCFRDSAQPS
AIPEASNPASDPASDGLEAIVTVTETLEELQLPQEAMESESRGAIYSIPIMEDGGGGSST
PEDPAEAPRTVPEFETQSMVPPTVFSEEEGKALEEEEKYEDEEEKEEEEEEEEVEDEALW
AWPSEFSSPGPEVSLPTEPAAQESLSQAPARAVLQPGVSPLPDGESETPMPPRVHGPPTE
TLPSPRERNLASPSPSTLAGAREAGEETGGPELSGVPRGESEETGSSEGAPSLLPATRAP
EGTRELEAPSEDNSGRTAPAGTSVQAQPVLPTDSASRGGVAVVPASGDCVPSPCHNGGTC
LEEEEGIRCLCLPGYGGDLCDVGLSFCNPGWDAFQGACYKHFSTRRSWEEAETQCRMYGA
HLASISTPEEQDFINNRYREYQWIGLNDRTIEGDFLWSDGVPLLYENWNPGQPDSYFLSG
ENCVVMVWHDQGQWSDVPCNYHLSYTCKMGLVSCGPPPELPLAQVFGRPRLRYEVDTVLR
YRCREGLTQRNLPLIRCQENGRWETPQISCVPRRPVSDRRRQARALHPEKDPEGRQGRLL
GRWKALLIPSSSPTPGP
Download sequence
Identical sequences ENSPANP00000010953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]