SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010963 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010963
Domain Number 1 Region: 144-197,324-462,499-545
Classification Level Classification E-value
Superfamily SAICAR synthase-like 7.85e-74
Family Inositol polyphosphate kinase (IPK) 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010963   Gene: ENSPANG00000015976   Transcript: ENSPANT00000009653
Sequence length 549
Comment pep:known_by_projection chromosome:PapAnu2.0:2:86614752:86639753:1 gene:ENSPANG00000015976 transcript:ENSPANT00000009653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRPLWPRPQSPPFPEAAAANPGTLATAPFRLSSPRAQLLGRANSEGHRERGAGGGARPG
CSHFGARETIGRKRRGTRLRQQQSILARTSQGATTRGTHRQQTEDVLAAGLRCLYLPAIC
ARRMSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPA
EMRKFTPQYKGVVSVRFEEDEDRNLCLIAYPLKGDHGIVDIVDNSDCEPKSKLLRWTTNK
KHHVLETEKTPKDWVRQHRKEEKMKSHKLEEEFEWLKKSEVLYYTVEKKGNISSQLKHYN
PWSMKCHQQQLQRMKENAKHRNQYKFILLENLTSRYEVPCVLDLKMGTRQHGDDASEEKA
ANQIRKCQQSTSAVIGVRVCGMQVYQAGSGQLMFMNKYHGRKLSVQGFKEALFQFFHNGR
YLRRELLGPVLKKLTELKAVLERQESYRFYSSSLLVIYDGKERPEVVLDSDAEDLEDLSE
ESADESAGAYAYKPIGASSVDVRMIDFAHTTCRLYGEDTVVHEGQDAGYIFGLQSLIDIV
TEISEESGE
Download sequence
Identical sequences ENSPANP00000010963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]