SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010964 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010964
Domain Number 1 Region: 166-418
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.35e-68
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.00026
Further Details:      
 
Domain Number 2 Region: 468-779
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.2e-43
Family Extended AAA-ATPase domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010964   Gene: ENSPANG00000016300   Transcript: ENSPANT00000018354
Sequence length 863
Comment pep:known_by_projection chromosome:PapAnu2.0:8:43964308:43980615:1 gene:ENSPANG00000016300 transcript:ENSPANT00000018354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPASTPSRRGSRRGRTTPAQTPRSEDARSSPSQRPRGEDSTSTGELQPMPTSPGGDLQ
SPVAQDVLFSSPPQMHSSAIPLDFDVSSPLTYGTPSSRVEGTPRSGVRGTPVRQRPDLGS
AQKGLQVDLQSDGAAAEDIVASEQSLGQKLVIWGTDVNVATCKENFQRFLQRFIDPLAKE
EENVGIDITEPLYMQRLGEINVIGEPFLNVNCEHIKSFDKNLYRQLISYPQEVIPTFDMA
VNEIFFDRYPDSILEHQIQVRPFNALKTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQ
EAFFQCQVCAHTTRVEMDRGRIAEPSVCGRCHTTHSMALIHNRSLFSDKQMIKLQESPED
MPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVPIRINPRVSNVKSVYKTHIDVIH
YRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGI
LLQLFGGTRKDFSHTGRGKFRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSA
VGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAK
AGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDR
RLAHHLVSLYYQSEEQAEEELLDMAVLKDYIAYAHSTIMPRLSEEASQALIEAYVDMRKI
GSSRGMVSAYPRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREALKQSATDPRTGI
VDISILTTGMSATSRKRKEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMF
EEALRALADDDFLTVTGKTVRLL
Download sequence
Identical sequences A0A096NDL7 A0A2K5LP93 A0A2K5YDT9 A0A2K6DXJ3
XP_011765852.1.29376 XP_011825818.1.47321 XP_011929876.1.92194 ENSPANP00000010964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]